(data stored in ACNUC7421 zone)

EMBL: CP000271.ORF20

CP000271.ORF20       Location/Qualifiers
FT   CDS_pept        complement(686188..687570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orf20"
FT                   /locus_tag="Bxe_B2441"
FT                   /product="tetrahydromethanopterin biosynthesis protein"
FT                   /function="Putativedihydropterin-
FT                   ribofuranosylaminobenzene- 5-phosphatesynthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2441"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33550"
FT                   /db_xref="GOA:Q13QT9"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QT9"
FT                   /protein_id="ABE33550.1"
FT                   /translation="MDHIVFLTGRLAEKSLLRVLESMAPTPFTWEIREIGLQVAALMTA
FT                   DLIRRRVPAPLAAQRVIVPGRCRGDLAALTEHYGVPFERGPEEVKDLPQFFGREAQPFD
FT                   LTRYETDIFAEIIDAPRLDLDGIAARAREYAAQGADVIDIGCLPETPFPHLEDAVRLLK
FT                   DEGYRVSVDSMSGDELLRGGRAGADYLLSLNLDTLWIADEVPSTPVLVAREPGDPASLD
FT                   AAIDLLAARGRAFLADPILDPIPFGLAASIARYVRLRERYPDVAIMMGIGNVTELTEAD
FT                   TSGINAVLLGIAAELRVSAVLTTSVSLHARRAVREADVARRVMHAAREAQVLPKGIDSD
FT                   LATVHAKRPFPYSAAEIDEFARDIRDPNFRVQISTDGIHVYNRDGHRKGHDPFALYPAL
FT                   HLEADGGHAFYMGVQLARAEIAWRLGKRFDQDQPLDWGCALDRNEQDLMVWREPGETRK
FT                   KG"
     atggatcaca tcgtcttcct gactggccgg ctcgccgaaa agagcctgct gcgcgtgctc        60
     gaaagcatgg cgcccacgcc gttcacttgg gaaatccgcg aaatcggcct gcaggtcgcc       120
     gcgctcatga cagcggatct gatccgccgc cgggtgcccg cgccactcgc cgcgcagcgc       180
     gtgatcgtgc ccggccgctg ccgcggcgat ctcgccgcgc tgaccgaaca ctacggtgtg       240
     ccgttcgagc gcggtccgga agaggtcaag gacctgccgc aattcttcgg ccgcgaggcg       300
     cagccgttcg atctaacgcg ttacgagacc gacatttttg ccgagatcat cgatgcaccg       360
     cggctcgatc tggacggcat cgccgcgcgg gcgcgcgagt atgccgcgca gggtgccgat       420
     gtgatcgaca ttggctgcct gcccgaaacg ccgtttccgc atctcgaaga cgcggtgcgc       480
     ctgctgaaag acgaagggta tcgcgtaagc gtcgattcga tgagcggcga tgaactgctg       540
     cgcggcggcc gcgcgggcgc ggattatctg ctgagcctga acctcgatac gctatggatc       600
     gcggacgagg tgccgtccac gccggtcctc gttgcccgcg aaccgggcga ccccgcctcg       660
     ctcgacgccg cgatcgacct cctcgccgcg cgcgggcgcg cgtttctcgc cgacccgatt       720
     ctcgatccga ttccgttcgg cctcgccgca tcgattgcgc gttatgtccg gttgcgcgag       780
     cgctacccgg acgtcgccat catgatgggc atcggcaacg tgaccgagtt gaccgaggcc       840
     gacaccagcg gcatcaacgc ggtcctgctc ggcatcgcag cggagcttcg cgtgagcgcg       900
     gtgctcacca cgtccgtcag cctgcatgcg cggcgcgcgg tgcgcgaagc ggacgtggct       960
     cgccgggtga tgcacgccgc gcgcgaggcg caggtgctgc ccaagggcat cgacagcgat      1020
     ctcgcgacgg ttcacgccaa acgcccattt ccatacagcg ccgccgaaat cgacgagttc      1080
     gctcgcgata tacgggatcc taactttcgc gtccagatca gtaccgacgg cattcatgtc      1140
     tacaaccggg atggacatcg caaaggccat gatccgtttg cgctttaccc ggcgttgcat      1200
     ctggaagccg atggcggaca cgcgttttat atgggtgttc agttggcgcg tgcggagatt      1260
     gcgtggcggt tgggcaagcg gttcgatcag gatcaaccgc ttgactgggg gtgcgcgctc      1320
     gatcggaatg agcaggattt gatggtgtgg cgtgaaccgg gagagaccag gaagaagggg      1380
     taa                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page