(data stored in ACNUC7421 zone)

EMBL: CP000271.ORF21

CP000271.ORF21       Location/Qualifiers
FT   CDS_pept        670818..671408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orf21"
FT                   /locus_tag="Bxe_B2457"
FT                   /product="tetrahydromethanopterin biosynthesis protein,
FT                   putative kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2457"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33534"
FT                   /db_xref="GOA:Q13QV5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QV5"
FT                   /protein_id="ABE33534.1"
FT                   /translation="MWVVKIGGSLSHEPTLRHWLTELCEVGGGRVVIVPGGGDFADKVR
FT                   QYQSEWRFDDLAAHNMCLLAMTQYAILMQGVLPELVLASSEAKIRRALRDGHVAVWVPT
FT                   ALMRDTPDAMSNWDTTSDSLAAWLSTMLNAERLIVVKSCPIAEDERLETLAASGVVDRC
FT                   FVDYVNEANYVVELFNKDNVALMRDRLLNTPVS"
     atgtgggtgg tcaagatcgg gggcagcctg agtcacgagc cgacgctgcg ccactggctc        60
     accgagctat gcgaagtggg gggtgggcgc gtcgtcatcg tgcccggcgg gggcgatttc       120
     gcggacaagg tgcggcaata ccagagcgag tggcgcttcg acgatctcgc cgcgcacaac       180
     atgtgtctgc tcgccatgac gcaatacgcg attctgatgc aaggggtctt gcctgaactc       240
     gtgctcgcct cgagcgaggc gaagatccgc cgcgcgctgc gcgacggcca tgtcgccgtg       300
     tgggtgccga ccgcgctgat gcgtgacacg ccggacgcga tgagcaactg ggacaccacc       360
     tccgacagtc tcgccgcgtg gctctccacc atgctcaacg ccgagcggct gatcgtggtg       420
     aagtcatgcc cgatcgccga ggacgagcgg ctcgaaacgc tggctgcctc gggcgtggtc       480
     gaccggtgtt tcgtcgacta tgtgaacgag gccaattacg tggtcgaact gttcaacaag       540
     gacaatgtgg cgttgatgcg cgaccggctg ctgaatacgc cggtcagcta g                591
//

If you have problems or comments...

PBIL Back to PBIL home page