(data stored in ACNUC7421 zone)

EMBL: CP000271.ORF22

CP000271.ORF22       Location/Qualifiers
FT   CDS_pept        complement(671485..672228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orf22"
FT                   /locus_tag="Bxe_B2456"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2456"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33535"
FT                   /db_xref="GOA:Q13QV4"
FT                   /db_xref="InterPro:IPR007565"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QV4"
FT                   /protein_id="ABE33535.1"
FT                   /translation="MTALLASVRSDEEAFDAAQAGAELIDLKEPNAGALGGLSIGDITQ
FT                   IARRLRAHYPVKPISATIGDVPADALDEITTRVIEVSDAGIDYVKVGVTPGPAARRCLE
FT                   QLANLPAAVVPVLLCDGGMDGELVAYAATLDFVGVMFDTAGKDGSTLFDHVDSDTLAQW
FT                   LRITRERGAMSGIAGSLGWAQFEQIRALAPDVAGFRTALCVDGRRSRLDPQRVAQWAAA
FT                   LHRPSGEVSGAVAAADTRASGTARF"
     atgaccgcat tgctcgcgag cgtccgctcg gacgaggagg cgttcgacgc cgcccaggcc        60
     ggcgccgaac tgatcgacct gaaggagccg aacgcgggtg cgctcggcgg tttgtcgatc       120
     ggcgacatca cgcagatcgc gcgccggctg cgcgcccatt acccggtcaa gccgatcagc       180
     gcgacgatcg gcgacgtgcc ggcggatgcg ctcgacgaga tcacgacacg cgttatcgaa       240
     gtgagcgacg cgggcatcga ttatgtaaaa gtgggcgtga cgcccggacc ggccgcacgg       300
     cgctgcctcg aacaactggc caacctgccg gcggcggtcg tgccggtgct gctatgcgac       360
     ggcggcatgg acggcgaact ggttgcctac gcggccacgc tcgacttcgt gggcgtgatg       420
     ttcgacaccg ccggcaagga cggcagcacg ctgttcgacc atgtggatag cgacacgctc       480
     gcccagtggt tgcggatcac acgcgagcgc ggcgccatga gcggcattgc cggctcgctc       540
     ggctgggcgc agttcgagca gatccgtgcg ctcgcgccgg acgtggcggg ttttcgcacc       600
     gcgctatgtg tggatggcag gcgctcgcgg ctcgatccgc agcgcgtcgc gcaatgggcc       660
     gccgcgctgc accgtccgtc gggcgaggtc agcggcgcgg tcgcggcggc ggacacgcga       720
     gcttcgggta cggcgcgttt ttga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page