(data stored in ACNUC7421 zone)

EMBL: CP000271.ORF5

CP000271.ORF5        Location/Qualifiers
FT   CDS_pept        complement(693369..694403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orf5"
FT                   /locus_tag="Bxe_B2434"
FT                   /product="SSU ribosomal protein S6P modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2434"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33557"
FT                   /db_xref="GOA:Q13QT2"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QT2"
FT                   /protein_id="ABE33557.1"
FT                   /translation="MSFPVPGAEPADSRATLRIAIMTDETGWHTGRLKKAFRARGAQAR
FT                   CIDLADCRIDTTWEPHGLVLPGFGHTLPDAVFVRGIAGGTFEQVTLRLGILHALRESGV
FT                   PVYNDARAIERSVDKSMTSFLLHRNGVPTPATWAGESAAFAQRVLMREAAAGRQVVLKP
FT                   LFGSQGHGLKRLGAGGAHPGALAPLPSLKAYRQVAYLQRYIEGGRPGFDWRVLVIGGRA
FT                   VAAMRRVGGKGWIHNFAQGAACEAAELDLPLAQTAVRATEALGLDYAGVDLIPDPRDAA
FT                   RPLVLEVNGVAAWRGLQSVTSIDIAAALADDLLLRKLPAQRRALSESAETREAAVVALH
FT                   GRHG"
     atgagtttcc ccgtgcccgg cgcagagccc gccgattcgc gagcgaccct gcgcattgcg        60
     atcatgaccg acgaaacggg ctggcatacc ggtcgcctga aaaaggcctt ccgcgcgcgc       120
     ggcgcgcagg cgcgctgtat cgatctggcg gactgccgga tcgataccac atgggagccg       180
     catgggctgg tgctgccggg gttcggccac acgctgccgg acgcggtttt cgtgcgcggc       240
     attgccggcg gcaccttcga gcaggtcacg ttgcggctgg gtatcctgca tgcgctgcgc       300
     gagtccggtg tgccggtgta caacgacgcg cgcgcgatcg aacgcagcgt cgataaatcg       360
     atgacgagtt ttctgctgca tcgcaacggc gtaccgacgc ccgcgacatg ggccggcgaa       420
     tccgcggcgt ttgcgcagcg cgtactgatg cgcgaagcgg cggccggacg ccaggtcgtg       480
     ctcaagccgc tgttcggctc gcagggccac gggctcaaac ggctcggcgc gggcggcgcc       540
     caccccggcg cgctggcgcc gctgccttcg ctcaaagcgt atcggcaggt ggcgtatctg       600
     cagcgctata tcgaaggcgg ccggccgggt ttcgactggc gcgtgctggt gatcggcggc       660
     cgtgccgtgg cggcgatgcg gcgcgtcggc ggcaagggct ggattcataa cttcgcgcag       720
     ggcgccgcgt gcgaagccgc cgaactcgat ctgccgctcg cgcaaaccgc ggtgcgggcc       780
     acggaagccc tcggactcga ctatgcgggc gtcgacctga tccccgatcc acgcgacgcc       840
     gcccggccgc tcgtgctcga agtcaatggc gtggcggcgt ggcgcggcct gcaatcggtc       900
     acgtcgatcg atatcgcggc ggcgctcgcc gacgacctgc tcctgcgcaa gctgcccgca       960
     cagcgccgcg ccctcagcga gtccgctgaa acccgcgagg ccgccgtcgt ggcgttgcac      1020
     ggacgtcatg gctga                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page