(data stored in ACNUC7421 zone)

EMBL: CP000271.ORF9

CP000271.ORF9        Location/Qualifiers
FT   CDS_pept        669559..670692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orf9"
FT                   /locus_tag="Bxe_B2458"
FT                   /product="tetrahydromethanopterin biosynthesis protein,
FT                   putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2458"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33533"
FT                   /db_xref="GOA:Q13QV6"
FT                   /db_xref="InterPro:IPR002756"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QV6"
FT                   /protein_id="ABE33533.1"
FT                   /translation="MSTAHVTHASSATLDSGPVFGWDVGGAHVKVSMADASGVVLDIAQ
FT                   WACPLWQGLDHLERTIDLVFERWPLAHTGAAQHAVTMTGEMVDLFEDRAQGVRAIAAAL
FT                   AERLGPRLCFYAGDAGWLTAQACAAGWRSVASANWLATARWVATRVPDALLIDIGSTTT
FT                   DIIPLAGGRVVARAATDAGRLATGELVYQGVVRTPLCGVAQRIEFAGTAVNVMNEWFAT
FT                   TADVYRLTGELAPQYDLYPCADQGPKTENASRTRLARMIGRDAHETDPAEWRRFALRWR
FT                   ELQLREIGVNLARVTAAHPELATAPLVGAGCGRFLAAALAREEARGYIDFGTLASVPAS
FT                   RSDWAATCAPSVAVALLAAARGGEAADENRSAASRAA"
     atgagcaccg cgcatgtcac gcatgcaagt tccgcgacgc tggatagcgg gccggtgttc        60
     ggctgggacg tgggcggcgc gcatgtgaag gtatcgatgg ccgatgccag cggcgtcgtg       120
     ctcgatatcg cgcaatgggc gtgtccgttg tggcaggggc tcgaccatct ggagcgcacc       180
     atcgacctcg tcttcgagcg ctggccgctc gcgcacactg gcgccgcgca acacgcggtg       240
     acgatgaccg gcgagatggt cgacctgttc gaggaccgcg cgcagggcgt gcgggcgatc       300
     gccgccgcgc tggcagagcg gctcgggccg cggctctgct tctacgccgg cgacgccggc       360
     tggctcacgg cgcaggcctg cgcggccggc tggcgcagcg tcgcctcggc gaactggctg       420
     gcgaccgcgc gctgggtggc gacgcgcgtg cccgatgcgc tgctcatcga catcggcagc       480
     acgaccaccg acatcattcc gctcgcgggc ggccgtgtcg tcgcgcgcgc cgcgaccgac       540
     gccgggcggc tcgccacggg cgagctcgtg tatcaggggg tggtgcgcac gccgttgtgc       600
     ggtgtcgcgc agcgcatcga attcgccggg acggccgtca acgtgatgaa cgaatggttc       660
     gcgaccacgg cggacgtcta ccggctcacg ggtgaactgg cgccgcagta cgacctgtat       720
     ccgtgcgccg accaggggcc gaagacggaa aacgcaagcc gcacgcggct cgcgcggatg       780
     atcggccgcg atgctcatga aacggatccc gccgaatggc gccggttcgc gctgcgctgg       840
     cgtgaactgc aactgcgaga aatcggcgtc aatctggcgc gggtgacggc ggcgcaccct       900
     gaactcgcca ccgccccgct ggtgggtgcg ggctgcggac ggtttctcgc ggcggcgctc       960
     gcgcgtgaag aggcgcgcgg gtatatcgat ttcggtacgc tggcgagtgt gccggcgagc      1020
     cggtcggact gggctgcgac gtgcgcgccg agtgtggcgg tggcattgct ggcggcagcg      1080
     cgcggcggcg aagccgctga tgaaaaccgt agcgcggcat cgcgggcggc ttga            1134
//

If you have problems or comments...

PBIL Back to PBIL home page