(data stored in ACNUC7421 zone)

EMBL: CP000271.ORFY

CP000271.ORFY        Location/Qualifiers
FT   CDS_pept        complement(695406..696614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orfY"
FT                   /locus_tag="Bxe_B2432"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Required for methylotrophy"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2432"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33559"
FT                   /db_xref="GOA:Q13QT0"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016677"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QT0"
FT                   /protein_id="ABE33559.1"
FT                   /translation="MKPRPSLPSAPFVAVAGLSARMLAQSAARAGLRVAALDVFGDRDT
FT                   REASELWFDIGGGPLSIDAERLVAALERTARLPGLIGWIDGSGLEPFVARLCGMPRLPR
FT                   FIGNPVEASAAVREPRRFFALLDALEIAHPPVVFAPPAVAHGWLVKRADGCGGTHIEPA
FT                   AAFGDPRIPAQIYFQRRRGGRSLSALFIAAFGHARVLGFAEQLTCEMGNLPFVHAGSIG
FT                   PIDLPLTVQARVHAAIAALCAQTRLTGINSCDFLLDGDAFELLEINTRPSSTMTLYETA
FT                   SPHAWPRGLLACHIEACRLGRLPAAPTPAAAPWRAGQQVLFAPHPFTVSQSFSDACLHD
FT                   PRCRDVPMPGTRIETGQPVCTLLVRAASVDAVRYALDAQRAFVLQRIDTCHEPDYAFIQ
FT                   CHS"
     atgaaaccgc gcccatcgct cccgtctgcg ccgttcgtcg ccgtggcggg actgtccgcc        60
     cgcatgctcg cgcagtccgc cgcgcgcgcg ggcctgcgcg tcgccgcgct cgatgtgttc       120
     ggcgaccgcg acacccgcga agcctcggag ctgtggttcg acatcggcgg tggcccgttg       180
     tcgatcgacg ccgagcggct cgtcgcggcg ctcgaacgta ccgcgcgttt gccgggtctc       240
     atcggctgga tcgacggcag cgggctcgag ccgttcgtcg cgcggttgtg cggcatgcct       300
     cggctgcccc gcttcatcgg caatcctgtg gaagcgagcg ccgcggtgcg cgagccgcgg       360
     cggtttttcg cgctgctgga cgcgctggag atcgcccacc caccggtcgt attcgcaccg       420
     cccgctgtgg cgcacggttg gctcgtcaaa cgcgcggacg gttgcggcgg cacgcatatc       480
     gaaccggctg ccgcgttcgg cgatccgcgt attcctgcgc aaatctattt ccagcggcgg       540
     cgtggcgggc gttcgttgtc ggcgctgttc attgccgcct tcggccacgc gcgcgtgctc       600
     ggcttcgctg agcaactcac ctgcgaaatg ggcaatctgc ccttcgtgca tgccgggtcg       660
     atcggtccga tcgatctgcc gctgaccgtc caggcgcgcg tgcatgcggc catcgccgcg       720
     ctgtgtgcgc agacccgcct gacgggcatc aatagctgcg attttctgct cgacggcgac       780
     gcgttcgaac tgctcgaaat caacacccgc ccttcgtcga cgatgacgct ctacgaaacc       840
     gcgtcgccgc atgcatggcc gcgcgggctg ctcgcgtgtc atatcgaagc gtgccggctc       900
     ggccgcctgc cggccgcgcc gacgcccgcg gcggcaccgt ggcgtgcggg tcaacaggtg       960
     ctgttcgcgc cgcatccatt caccgtctcc cagtccttca gcgacgcctg cctgcatgac      1020
     ccgcgctgcc gcgacgtgcc gatgcccggc acgcgcatcg aaaccggcca gccggtctgc      1080
     acgctgctcg tgcgcgcggc ttcggtagac gcggtgcgct acgcgctcga cgcgcagcgg      1140
     gcgttcgttc tgcaacgcat cgacacctgc catgagcccg actatgcctt catccaatgc      1200
     cactcctga                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page