(data stored in ACNUC7421 zone)

EMBL: CP000271.PE10

CP000271.PE10        Location/Qualifiers
FT   CDS_pept        complement(11713..12363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3019"
FT                   /product="putative YceI like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3019"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32978"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SG1"
FT                   /protein_id="ABE32978.1"
FT                   /translation="MSTLTLRATFVRAFLSAMLLTAAACTPLQVLTHSVSQNEARVPPG
FT                   RYEIDPDHCSITFDIDHFKYSRFTARFDRKKGELDWNEGGLDRSTTSVTIDAASIDTNV
FT                   PLLDKMVKSGSMLDVERYPEIRFVSTRFERTGESRGTLTGDLTIHGVTQPVTLDVTFNG
FT                   FAPDPLTKKDTLGFSAEGRFSRARFGLATWYPAVGDDIHVRIQAEFVKTPAGG"
     atgagcacac tgactctccg cgccacgttt gtgcgcgcct tcctgagcgc aatgctactg        60
     acggcggcgg cctgcacgcc tttgcaagtg ctcacgcatt cggtcagcca gaacgaagcg       120
     cgtgtgccgc cgggccgcta cgaaatcgat ccggatcact gcagcatcac cttcgacatc       180
     gatcacttca agtattcgcg ctttacggcg cgcttcgatc gcaagaaggg agagctcgac       240
     tggaatgaag gcggtctgga caggagcacg acgtcggtca cgatcgacgc cgcgagcatc       300
     gatacgaatg tgccgctgct cgacaaaatg gtgaagagcg gcagcatgct cgacgtggag       360
     cgctatccgg agatccgctt tgtcagcacg cgatttgagc gcaccggcga gtcgcgcggc       420
     acgttgaccg gcgatctgac gattcacggc gtcacgcaac cggtcacgct cgatgtcacc       480
     ttcaacggtt ttgcgcctga tccgctcacg aaaaaagaca cgctcggttt ttccgccgag       540
     ggtcgtttca gtcgcgccag gtttggactg gctacgtggt atccggccgt cggcgacgat       600
     attcatgtgc gcattcaggc cgagttcgtc aaaacgcccg caggcgggtg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page