(data stored in ACNUC7421 zone)

EMBL: CP000271.PE100

CP000271.PE100       Location/Qualifiers
FT   CDS_pept        115183..115569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2927"
FT                   /product="Hpt domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2927"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33068"
FT                   /db_xref="GOA:Q13S71"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S71"
FT                   /protein_id="ABE33068.1"
FT                   /translation="MKPVGATKQAGFAGDPHLLQQKALELAGGDHVTARRLLEMIAQTD
FT                   RTALAALRDSFRTASWDGVGSAAHRIAGSARMLECHEVFALLTRLEAAARGRDIVLATA
FT                   LLPHVADALGELGASIGKALTSTD"
     atgaagcccg ttggcgcgac gaagcaggcc gggtttgccg gcgaccctca tctgcttcag        60
     cagaaagcac tggaactagc gggcggcgac cacgttaccg cccggcgtct gctcgagatg       120
     attgcgcaaa ccgatcgaac ggcactcgcc gcgttgcgcg acagtttccg gaccgcttcg       180
     tgggatggcg tgggcagcgc ggcgcatcgc atcgcgggat cggcgcgcat gctggaatgc       240
     cacgaggtgt tcgcgctgct gacgcgactg gaagcggcgg cgcgtgggcg cgatatcgta       300
     ctcgcaacgg cacttctgcc gcatgtggcc gacgcgctcg gggagctcgg tgcatcgatc       360
     gggaaggcgc tgaccagtac cgactag                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page