(data stored in SCRATCH zone)

EMBL: CP000271.PE102

CP000271.PE102       Location/Qualifiers
FT   CDS_pept        complement(116441..117277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2925"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2925"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33070"
FT                   /db_xref="GOA:Q13S69"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S69"
FT                   /protein_id="ABE33070.1"
FT                   /translation="MNPPDLKLQQIPSRRTRLTGNARRTSQSGQSMTEFIIIAPVLLFV
FT                   CFGILQFVLLYQAKSTLDVAALEAAREGAVNHGSMQSMRNGLARGLAPLYAHQANAEGV
FT                   AAALASAQTDAARFSSITVLNPTPAAIQDYSRPRYYADQAATYSEIPNDSLMYRDSSVP
FT                   PGAMSRMNIQDANLLKIHVHYCYDMYVPLVNKVIYYAANVIGAIGTGGILTREPANVTQ
FT                   DPYGDPKNGDYLCKVKLADGIATGHWPISLDSEAMVRMQSPLRASALNDSPNPTGN"
     gtgaaccctc ccgatctgaa attgcagcaa attccgagcc gccgcacgag actgaccggc        60
     aacgcacgca ggacctcgca gtcgggtcag tcgatgacag agttcatcat catcgcgccc       120
     gtgctgctgt tcgtctgttt tggcatcctg cagttcgtgt tgctgtatca ggcaaagtcg       180
     accctggatg tggccgcact ggaggccgcc cgcgaaggcg cggtcaatca cggctcgatg       240
     cagtcgatgc gcaacgggct cgcacgcgga ctcgcacctc tttacgcgca tcaggcaaat       300
     gccgagggcg tcgcagcggc gctcgccagc gctcaaaccg acgcggccag attcagcagc       360
     atcaccgtcc tcaatcctac cccggcggcc attcaggact attcgcggcc ccgttactac       420
     gcggaccagg cggcaaccta ttcggaaata cccaacgact cgctgatgta tcgcgattcc       480
     tctgtgccac cgggtgcaat gtcgcgcatg aacattcagg acgccaacct gctgaagatc       540
     cacgtgcact actgctacga catgtacgtg ccgctggtga acaaggtgat ctattacgcc       600
     gccaacgtta tcggcgctat cggtacaggc ggcattctga ctcgcgagcc ggccaacgtg       660
     actcaggacc cgtacggcga tccgaaaaat ggcgactatc tctgcaaggt caaactcgcg       720
     gacggtatcg cgaccggcca ctggccaatc tcgctggatt cggaggcgat ggtgcgcatg       780
     cagtcgccgc tcagggcttc agccttgaac gactcgccga acccgacagg caattga          837
//

If you have problems or comments...

PBIL Back to PBIL home page