(data stored in SCRATCH zone)

EMBL: CP000271.PE103

CP000271.PE103       Location/Qualifiers
FT   CDS_pept        complement(117274..117624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2924"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2924"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33071"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S68"
FT                   /protein_id="ABE33071.1"
FT                   /translation="MKRARLHVRGHDIGVEVSITETARECMRGLLGRAALASGEALLLD
FT                   RCGSVHTFGMRFAIDVLFLDRRQRVVAIHHDVPRRRMLFSLRATHTLEMPAHSARRHGL
FT                   AVGDSLVFEATS"
     gtgaagcggg cgcgccttca cgttcgtggg cacgacatcg gcgtggaagt gtcgatcacc        60
     gaaaccgcgc gggaatgcat gcgcggtctg ctgggccgcg ccgcgctggc gtccggcgaa       120
     gcactgctgc tcgatcgctg cggatcggtc cacacgttcg gcatgcgctt tgccatcgac       180
     gtgctgtttc tcgaccggcg gcaacgcgtt gtcgcgatcc atcacgacgt acccaggcgg       240
     cgcatgttgt tcagcctgcg cgcaacccac accctggaga tgccggccca ctcggcgcgc       300
     cggcatggac tggctgtcgg cgattccctt gttttcgagg caacctcgtg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page