(data stored in ACNUC7421 zone)

EMBL: CP000271.PE104

CP000271.PE104       Location/Qualifiers
FT   CDS_pept        complement(117621..118502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2923"
FT                   /product="Putative type II secretion system protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2923"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33072"
FT                   /db_xref="GOA:Q13S67"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S67"
FT                   /protein_id="ABE33072.1"
FT                   /translation="MLLFIAFLVSFGLIAFIAVGYRSLNGLAGAVPEEDRLFLDPLPKS
FT                   LRPLWPLVNFVVHHFGNSFSAKLVEKTDLQLRLTSLTFLMNARQFIALSIIASILASLV
FT                   TLLLMLALGMFSVLILILVAALGYFYPRIWTRDVRRRRVAQILRHLPIYLDFLTLAVEA
FT                   GLNINGAIQKAVEKGPEGPLRRELEHVLRDLKSGLNRTEALRRLDDRLRIKEVTNLVGT
FT                   VVQAERMGSGLAKSLRFQSEQRRSERFQRAEKQAMEAPVKLVFPLLFFIFPITFIVLGF
FT                   PIAMKFVQEGLL"
     atgctgctat tcattgcctt tctggtcagc ttcggcctga tcgcattcat cgccgtcggc        60
     taccggtcgc tcaacggtct cgccggtgcc gtgcccgagg aggaccgtct cttcctcgac       120
     cccttgccga agtcgctccg gccgctgtgg ccgctcgtca atttcgtggt tcaccatttc       180
     ggcaactcgt ttagcgcgaa gctggtggaa aagaccgatc tgcaattgcg gctgacctcg       240
     ctcacgttcc tgatgaacgc gcgtcagttc atcgccttgt ccatcatcgc ttcgattctc       300
     gcttcgctcg ttacgctgtt gctcatgctg gcgcttggca tgttttcggt gctgatattg       360
     atcctcgtcg ccgcactcgg ctacttctat ccgcgcatct ggacacgtga tgtgcgccgc       420
     cgccgcgtcg ctcagattct caggcatctg ccgatctatc tcgactttct gacgctcgcc       480
     gtcgaagccg gcctgaatat caacggtgcg attcagaagg ccgttgaaaa aggcccggag       540
     ggtccgttgc gccgggagct cgaacacgtg ctacgcgatc tcaagtccgg gttgaaccgc       600
     acggaagcac tgcgccgcct cgacgaccgg ctgcgcatca aggaggtcac gaatctggtg       660
     ggcacagttg ttcaggcgga acgcatgggt tcgggactgg cgaagtcgtt gcgctttcag       720
     tccgaacagc gccgctcgga acgtttccag cgtgccgaga agcaggcaat ggaagcgccg       780
     gtgaaactcg tgttcccgct tctgttcttt atcttcccga tcacctttat cgtgctggga       840
     ttcccgattg cgatgaaatt cgtgcaggag ggtttgctgt ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page