(data stored in ACNUC7421 zone)

EMBL: CP000271.PE105

CP000271.PE105       Location/Qualifiers
FT   CDS_pept        complement(118506..119354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2922"
FT                   /product="Putative type II secretion system protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2922"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33073"
FT                   /db_xref="GOA:Q13S66"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S66"
FT                   /protein_id="ABE33073.1"
FT                   /translation="MSLPLILALAFFGSLFLIFLLSRMGTSTLRAGSRQMAGEIESSLA
FT                   DAFVFVNRQKAAAWSMVVMVGLPVIVFLFSHSILFALASVPIAMMLPKKYLKRMRKKRI
FT                   EALEKQLPDALLMMSGALRAGASFPAALEAVVYETAPPISQEFDLLMREIRLGIDLDIA
FT                   MRNVEKRIPIPDLLMMTAAVTIAREVGGNLAEALESVARTLREKLQMEGKIRALTSQGR
FT                   MQGIVMTCLPLFLMLVLRFMEAKAMAPLFSEPVGWATLAVIGVMECLGYFWISRITNID
FT                   V"
     atgagtcttc cccttattct cgcgctggca ttctttggca gcctgttcct gatctttctg        60
     ctctcgcgca tgggcacctc cacgctcagg gccggctcgc gccagatggc gggcgaaatc       120
     gaatcgtcgc tcgccgacgc cttcgtgttc gtcaaccgcc agaaggccgc ggcgtggagc       180
     atggttgtca tggtcggctt gccggtcatc gtctttctgt tcagccacag cattctgttc       240
     gcgctggcat ccgtgccgat cgccatgatg ctgccgaaga aatacctcaa gcgcatgcgc       300
     aagaagcgca tcgaggcgct ggagaaacag ttgccggacg cgttgctgat gatgtccggc       360
     gcattgcgcg ccggcgcaag ctttcccgcg gcgctcgaag ctgtcgtcta cgagaccgcg       420
     ccacccatct cacaggaatt cgacctgttg atgcgtgaaa tccgcctcgg catcgatctg       480
     gacatcgcca tgcgaaacgt cgaaaaacgc attccgattc ccgacctgct gatgatgacc       540
     gcggccgtca cgatcgcgcg cgaagtgggc ggcaatctgg ccgaagcgct cgagtccgtt       600
     gcgcgcacct tgcgcgaaaa gctgcagatg gaaggcaaga tcagggcgtt gacatcacaa       660
     ggccgcatgc agggcatcgt gatgacctgt ctgccgctct ttctgatgct cgtactgcgt       720
     ttcatggaag ccaaggcaat ggcgccgctt ttcagcgagc cggtgggctg ggccacgctg       780
     gcggtcatcg gcgtgatgga gtgcctcggc tacttctgga tttccaggat caccaacatc       840
     gacgtgtga                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page