(data stored in ACNUC7421 zone)

EMBL: CP000271.PE106

CP000271.PE106       Location/Qualifiers
FT   CDS_pept        complement(119367..121283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2921"
FT                   /product="type II/IV secretion system protein E"
FT                   /note="Putative type II/IV secretion system-relatedprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2921"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33074"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S65"
FT                   /protein_id="ABE33074.1"
FT                   /translation="MLNLQVHARNAPVRTLQVEQGCTIGKDASCDVIVKGLLIGKLQAR
FT                   IVREHNAYYIEDQGGIAATLVNGTAITRYGPLTEADQIEVGVTTIRIVRAAVAAQPQPQ
FT                   DAQHGQQAAQPSSETAHAGHAATPVARPLQAPASAHIEPSFAVAAQVQPMPEPFHPPAV
FT                   ERNAAPAGHYAPARHESIAMPTQRAAEVPPRTPPPQVKKTAAAPLPVAPINSPLGIELR
FT                   KQAHMKVIAALDLRRLNVARMEEDELRKTVSAALDDILNHDASFHTADIPLSALKKSVF
FT                   DEIIGLGPLEELIADPTVSEIMVNCHNEIFIEQNGQLTRSPVIFTDDRAVLGAIERIVA
FT                   PIGRRIDESSPMVDARLSDGSRVNAVIPPLALKGPSITIRKFSRQKLGGEDLIRFGSMS
FT                   PDMLEFLHTAVKEGANIVISGGTGSGKTTLLNVLSSYIPDDERIVTVEDAAELQLSQPN
FT                   LVSLEARPANMEGKGAIHIRDLVKNCLRMRPDRIVIGECRGGEALDMLQAMNTGHDGSL
FT                   TTAHANTPRDCIARLEVMTLMAGLDLPVQAIREQICSAVDLIVQQSRFSCGSRRVTHVT
FT                   EVSGMESGVITLQDVFVFKEEGFSEHGKIQGKFVPTAYVPDFYQELIRRRIPVNTDIFT
FT                   RIE"
     atgctcaatc ttcaggtaca cgcgcgcaat gcgcccgttc gcacacttca ggtcgaacag        60
     ggctgtacga tcggcaagga cgcgagctgc gacgtgattg tcaagggcct gctgatcggc       120
     aagctgcagg cgcgcattgt cagagaacac aacgcctatt acatcgagga ccagggtggc       180
     attgcggcca cgcttgtcaa cggtacggcg atcacccgct atggcccgtt gaccgaggca       240
     gaccagatcg aagtcggcgt gaccacgatc agaatcgttc gtgccgcagt cgccgcccag       300
     ccgcagcctc aggatgcaca gcatggacag caggcggccc agccgtcgtc tgaaacggcg       360
     catgccggcc acgctgcgac gccagttgcg cggccgctgc aagcccctgc gtccgcgcac       420
     attgagcctt cgtttgccgt tgcggctcag gtgcaaccaa tgccggagcc gttccaccca       480
     cctgcggtcg agcgcaatgc agcgcctgcc ggccactacg cgccggcacg gcacgagagc       540
     atcgccatgc caacccagcg cgcggccgaa gtgccgccgc gcacgccgcc cccccaggtg       600
     aaaaaaaccg ccgcggcgcc gttgcctgtc gcgccgatca acagcccgct cggtatcgaa       660
     ctgcgcaaac aggcgcatat gaaggtgatc gcggcactcg acctgcgtcg tctgaatgtt       720
     gcgcgcatgg aggaggacga actgcgcaag actgtcagcg ccgcgctcga cgacattctg       780
     aatcacgacg ccagcttcca cactgccgac attccgctca gcgcgctgaa gaaaagcgtg       840
     ttcgacgaaa tcatcggact cggaccgctc gaagagctga tcgcggatcc gacggtgtcg       900
     gaaatcatgg tcaattgcca caacgaaatt ttcatcgagc agaacggtca gctcacccgt       960
     tcgcccgtga tcttcaccga cgaccgcgcg gtgctcggcg ccatcgagcg aatcgttgcg      1020
     cctatcggcc gccgtatcga cgaaagctcg ccgatggtcg acgcccgtct gtccgacggc      1080
     tcgcgggtga acgccgtgat tcccccgctc gcgctgaaag gccccagcat cacgatccgg      1140
     aaattctcca ggcagaaact cggcggcgaa gacctgatca ggttcggctc aatgtcgccg      1200
     gacatgctgg agttccttca cacggcggtc aaggaagggg ccaacatcgt catctcgggt      1260
     ggcacgggtt cgggcaagac taccttgctg aacgtgctgt cgagctacat tcccgacgac      1320
     gagcgcatcg tcaccgtgga agacgccgcc gaacttcaac tgtcgcagcc gaacctcgtc      1380
     tcgctcgaag cgcgcccggc caacatggag ggcaaaggcg ccatacacat acgcgacctc      1440
     gtaaaaaact gcctgcggat gcggccggac cggatcgtga tcggcgagtg ccgcggcggc      1500
     gaggcgctgg acatgttgca ggccatgaac acgggccacg acggctcgct caccacggcg      1560
     cacgccaaca cgccgcgcga ctgtatcgcg cggctcgaag tgatgacgct catggcgggt      1620
     ctcgatcttc cggtgcaggc cattcgcgaa cagatctgct ctgcggtcga cctcatcgtg      1680
     cagcaatcgc gcttttcctg cggctcgcgc cgcgtcacgc acgtcaccga agtgagcggc      1740
     atggaatcgg gtgtgatcac gctgcaagac gttttcgtct tcaaggaaga aggtttcagc      1800
     gagcacggca agattcaggg caagttcgtc cccaccgcct atgtgcccga tttctatcag      1860
     gagttgattc gcaggcgcat tccggtgaat accgacatct tcacgcgcat cgaataa         1917
//

If you have problems or comments...

PBIL Back to PBIL home page