(data stored in SCRATCH zone)

EMBL: CP000271.PE107

CP000271.PE107       Location/Qualifiers
FT   CDS_pept        complement(121307..123094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2920"
FT                   /product="Putative type II and III secretion system
FT                   outermembrane protein, secretin"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2920"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33075"
FT                   /db_xref="GOA:Q13S64"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S64"
FT                   /protein_id="ABE33075.1"
FT                   /translation="MKVKNNAAPLRRRVLPSVLVGMLLCEAAPAALAQTAQAAHAAYTA
FT                   ATDSPSASTRVLEMFRGEVRILHIPGTIKRIAIGNGKLLTANVVDGSLMLLGEQDGITS
FT                   LVVWNDKGIALQTTVRIAKAEVNASLEQLRAVLRSVAGLRIDAIGSNIVLSGVIHRDMA
FT                   GTVKAATQEMKNVVDTTTFDEGDALRKTVHFKVQIMEVTRTGQRNLGIAWDSAFRGPQI
FT                   GGAASVATGAAKAITAGTSYFLAGIASNITSQINFAVENGDAYVLAAPELNTKSGGTAS
FT                   FLAGGQVPIPQSGALGTTSIEYKDYGIKLSIVPVVDANNIISAHLTTEISQIDPSVTYA
FT                   GMPGFLTRNTSSDISMRAGETLAISGLVSADAANDSNGMPFLSQVPIIGQLFRSDRFRA
FT                   KKSDLVIFVTPVISDPELSPNTDLLARADKLDENFRKEYGNTDPLVADEDKAKHVTTPR
FT                   QPIVPTPALLPTPVRSTPQVPAEPQASAPVVAGAEGPATPLAASVQTPAYVPAQIPAQA
FT                   AAPVSAQAPAQTQAAGAPAQLPPSPPPASTPPAGVAEALRMLNDPQHAQAMPAHDPMQP
FT                   ASNGKVPQQQIGVLGTSNN"
     atgaaagtca aaaacaatgc agcgccattg cgccgccggg tcctgccatc cgtcctcgtc        60
     ggcatgttgt tgtgcgaggc cgcgccggca gcgctggcac aaaccgcgca agccgctcat       120
     gccgcttaca ccgcggccac ggacagcccg tcggcgagca cccgtgtgct cgaaatgttc       180
     cgtggcgaag tgcggatcct gcacattccc ggcaccatca aacgcatcgc catcggcaac       240
     ggcaagctgc tcaccgcgaa tgtggtcgac ggcagcctga tgctgctcgg cgaacaggac       300
     ggcatcacct cgctcgtggt gtggaacgac aagggcattg cgctgcaaac cacggtgcgc       360
     atcgccaaag cggaagtcaa tgcttcgctg gaacagttgc gcgccgtgct caggtccgtc       420
     gcagggctgc gcatcgacgc gatcggttcg aatatcgtgc tgtccggcgt catccaccgc       480
     gacatggcgg gcaccgtcaa ggcggccacg caggagatga agaacgtggt cgacaccacc       540
     acgttcgacg aaggcgacgc gctgcgcaag accgtccact tcaaggtgca gatcatggaa       600
     gtgacccgca ccggccagcg caatctcggc attgcctggg acagcgcatt cagaggtccg       660
     cagatcggcg gtgccgcgag cgtcgcaacg ggcgccgcca aagccatcac ggccggcacg       720
     agctactttc tcgccggcat tgcttcgaac atcacctcgc aaatcaactt cgcggtagaa       780
     aacggcgatg cgtatgtgct cgccgcgccc gaactcaata cgaagagcgg cggcacggcg       840
     agttttctgg cgggcggcca ggtgccgatt ccgcagtcgg gcgcgctcgg cacgaccagc       900
     atcgaataca aggactacgg catcaagctg agcatcgttc cggttgtcga tgcgaacaac       960
     atcatctccg cgcatctcac cacggagatc agtcagatcg acccatcggt gacgtatgcc      1020
     ggcatgccgg gcttcctgac tcgcaacacg agttcggaca tctccatgcg ggccggcgag      1080
     acgctcgcca tttccggact ggtcagcgcg gacgcggcca acgattccaa tggcatgcca      1140
     tttctcagcc aggtgccgat catcgggcag ctgttccgct cggaccgctt ccgcgcgaag      1200
     aaaagcgatc tcgtgatttt cgtgacgccg gtcatttcgg atcctgaact ttcgcccaat      1260
     acggatttgc tcgcgcgtgc cgacaagctc gatgagaact tccgcaagga gtatggcaac      1320
     acggacccgc ttgtcgcaga cgaggacaag gcgaagcacg tcaccacgcc gcgtcagccg      1380
     atcgtgccga cgcctgcgct gcttcccacg ccggttcgca gcacgccgca agtgccggcc      1440
     gagccgcagg caagcgcgcc ggttgtggcg ggtgccgaag gtccggcgac cccactcgcg      1500
     gcgtcagttc aaacgccagc ctatgttccg gcccagatcc cggcccaggc agcggcaccc      1560
     gtttccgctc aagcgccggc ccagacgcag gccgccggcg cgccggcgca actgccgcca      1620
     tcaccgccgc ctgccagcac gccgccggca ggtgtcgccg aggcgctgcg catgctgaac      1680
     gacccgcagc atgcgcaagc catgccggct catgacccga tgcaacccgc ttcgaacggc      1740
     aaggtgccgc agcagcaaat cggcgtgctc ggcacgtcga acaactga                   1788
//

If you have problems or comments...

PBIL Back to PBIL home page