(data stored in ACNUC7421 zone)

EMBL: CP000271.PE109

CP000271.PE109       Location/Qualifiers
FT   CDS_pept        complement(124231..124437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2918"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2918"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33077"
FT                   /db_xref="GOA:Q13S62"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S62"
FT                   /protein_id="ABE33077.1"
FT                   /translation="MSKAELVSSFATRRSRQRGQAYAEYLVVTTVLVGALVVADSNAIA
FT                   PVAALLSSFKSFFSAYSFTLSLP"
     atgtcaaaag cagaacttgt ttcttccttt gcgacgcgac gcagccggca gcgcggccag        60
     gcctatgcgg agtatctcgt ggtcacgacc gttctcgtcg gcgcgctggt ggtggcggac       120
     agcaacgcca tagcgccggt cgccgctctc ctctcgagct tcaagtcgtt cttcagcgcc       180
     tatagcttca ccctttcgct tccctga                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page