(data stored in ACNUC7421 zone)

EMBL: CP000271.PE110

CP000271.PE110       Location/Qualifiers
FT   CDS_pept        complement(124439..125155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2917"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2917"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33078"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S61"
FT                   /protein_id="ABE33078.1"
FT                   /translation="MKYAYHLARGACLGSALLFTGNAVAANACNKTPVQPQSVQAIGRD
FT                   MIVNGVPTSVVGMQFSGTTEDVSRAFRDFWIREDVPAKGRTNSSGLLLSALDDHCLYIL
FT                   SIPPQPEGDHTRGLMSVVRLGSDQADHRIPDSAVPLPEESAILSDVESHDPGQTGRTWL
FT                   LDMPGNPQWNAQRYRNSLAAQGWVNVGRQPDYQSTGNRAAQGTAFAMQHGADSVDVSFS
FT                   DHGGRTAAVVNAIRNR"
     atgaaatatg cctatcacct ggcgcgtggc gcatgcctcg gcagcgcgtt gcttttcacc        60
     ggcaacgcgg tggcagccaa tgcgtgcaac aaaacacccg tgcagccaca aagcgtccag       120
     gctatcgggc gcgacatgat cgtgaacggc gtgcccacgt cggtggtggg catgcagttc       180
     tccggaacga ctgaagacgt atccagggcg tttcgtgatt tctggattcg cgaagacgtg       240
     ccggcgaaag gccgcaccaa ttcctccgga ctactgctca gcgcgctgga cgatcactgc       300
     ctgtacatac tcagtatccc gcctcaaccc gagggcgatc acactcgtgg gctcatgagc       360
     gtggtgcgcc tcggcagcga tcaggcggac caccggattc ccgattccgc cgttccgctg       420
     ccagaagaaa gcgcgatcct ctcggacgtc gaaagccacg atcccggcca gacgggccgc       480
     acctggctcc tcgatatgcc gggaaatccg caatggaatg cacagcgata tcgcaacagt       540
     ctcgccgcgc aaggttgggt gaacgtcggc cgccaaccgg attatcagtc caccggcaac       600
     cgcgccgcgc aaggcactgc attcgccatg caacacggcg cggacagtgt ggatgtcagt       660
     ttttcggatc acggcggcag aacggccgca gtcgtcaatg caatcaggaa ccgttga          717
//

If you have problems or comments...

PBIL Back to PBIL home page