(data stored in ACNUC7421 zone)

EMBL: CP000271.PE111

CP000271.PE111       Location/Qualifiers
FT   CDS_pept        complement(125152..126036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2916"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2916"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33079"
FT                   /db_xref="GOA:Q13S60"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S60"
FT                   /protein_id="ABE33079.1"
FT                   /translation="MKRIDMRNSGQSGQAMVEFLVSMTLVMSVLLLAIAMLGKFNDIRH
FT                   RTLMASRYLAWERTVWSDGDATKNLASDPGTTEGWSGTYGGAALSASKLDTELKREVMQ
FT                   RLMANDGSPISGTDLKQNELPASQPAMWRDYGGNPLLASSSDIAVSTGVAADPASSLNG
FT                   TALSQWAVPTATGGQYLAHLSLPTSTMRSGTLSLSVGGNSDVLKRFWPKDAALPAFSGL
FT                   AFSDTNVLMTNSWMPDGSASNKALFSQAVPAANAVLVPPGGYQGLQKYAPEITSLQFGR
FT                   VQQDVVPANRLKQ"
     atgaagcgaa tcgacatgag aaacagcggg cagtccggtc aggctatggt ggagttcctc        60
     gtttccatga ccctggtcat gagcgtgctg ttgctcgcca tcgccatgct cggcaagttc       120
     aacgacatcc gtcaccgaac gctgatggcc tcgcgttacc tcgcatggga acgcacggtg       180
     tggtcggacg gcgacgccac gaaaaatctc gccagtgatc cgggcaccac ggagggctgg       240
     tcgggcacat atggcggcgc cgcactctcg gcgagcaagc tcgataccga actcaagcgc       300
     gaagtgatgc agcgcctgat ggcaaacgac ggttcgccga tttcaggcac cgatctcaaa       360
     cagaatgaac tgcccgcctc ccagccggcc atgtggcgcg actatggtgg caatcccttg       420
     ctcgcctcgt cgtccgatat cgcggtcagc acgggcgtgg ccgccgatcc cgccagcagc       480
     ctgaacggca ctgccctctc ccagtgggcc gtacccactg caaccggtgg ccagtatctc       540
     gcccacctga gtttgccgac gagcacgatg cgatccggca cgctcagcct gtcagtcggc       600
     gggaacagcg acgtgctcaa gcgattctgg ccgaaagacg ccgctcttcc tgcgttcagc       660
     ggcctcgcgt tctcggacac caatgtgctg atgaccaaca gctggatgcc ggacggctcc       720
     gccagcaaca aggctctgtt cagccaggcg gtgccggccg ccaatgccgt gctcgttccg       780
     ccaggcggct atcaaggctt gcagaagtac gcgccggaga tcacgtcgtt gcagtttggc       840
     cgcgttcagc aagacgtcgt acccgcaaac cgtctgaaac aatga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page