(data stored in ACNUC7421 zone)

EMBL: CP000271.PE112

CP000271.PE112       Location/Qualifiers
FT   CDS_pept        complement(126033..127565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2915"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2915"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33080"
FT                   /db_xref="GOA:Q13S59"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S59"
FT                   /protein_id="ABE33080.1"
FT                   /translation="MKRSARKGRVRVAGASGQALVPALIFLLAGCIGLYVAFNSFQMTS
FT                   AKIKLQNTADAAAYSAAVLQARDYNFSAYTNRAMIANQVTAAQVVALKSWIDELDATYS
FT                   LSELDEAVDSLADHPAQWSTPKQLGKNDIAPVRAALDALLPTVARNIGSLNRALSVAQA
FT                   NYHAAVITTVPDTADTVAQLNQPDTHVTSGYFTGSRNAAQLAAWTSYTATVIPAGTLGA
FT                   DEFADVVTAPGTLDGFVKNRNSNRSVAPNFQQLTDTAIRICGGANSTFTVNVTHAGGTQ
FT                   LRSDKSGWQSIDASTAQLNVSCLETFGDVAGSGGSANGNITSFMTNPPFAAWQDWQGYG
FT                   GYFNFGYQGSLTPGWQVPEAMAHQFSVGPGPSLDPANGGLLPYQEVNGARPGSEAPRIT
FT                   IEVTRNSDTLVKTIGLQGGGRMAVADNAAGGAMRALSSANAYFVRPDETSIGGSIMGGL
FT                   LNGSQWARADHATEYPSLFSPYWQARLAPVSDEERAAAQASQMSAATQVQKP"
     atgaaacgct ctgcccgcaa gggcagggtc agggtcgccg gcgctagcgg gcaggcgctg        60
     gtccctgcac tgatttttct tctggccggc tgtatcggtc tgtatgtggc attcaactcg       120
     ttccagatga cgagtgccaa aatcaaactt cagaacactg ccgacgccgc cgcctatagc       180
     gccgccgtcc tgcaggcacg cgactacaac ttctccgcgt acaccaaccg cgccatgatc       240
     gccaatcagg tcaccgccgc gcaggtggtc gcactgaagt cgtggatcga cgagctcgac       300
     gccacttact cgctatcgga actcgacgaa gcggtcgatt cactggcgga tcacccggct       360
     caatggagca cgcctaaaca gctcggcaaa aacgacatcg cgccggtgcg cgcagcgctg       420
     gacgcactgc tgccaaccgt ggcgagaaac attggctcgc tcaaccgtgc attgagcgtc       480
     gcgcaggcga actaccatgc ggcggtgatc accacggtcc ctgacaccgc ggatacggtc       540
     gcgcaactca atcagcccga cacgcacgtc acaagcggat atttcaccgg ctcgcgcaac       600
     gcggcgcagc tcgcggcgtg gacctcctac acggccacgg tcattcccgc gggcacgctc       660
     ggagcggatg aattcgccga tgtggtgacg gccccaggca cgctggacgg cttcgtcaag       720
     aaccgcaatt cgaatcgcag cgtcgcgccc aacttccagc aattgaccga cacggccatc       780
     cgcatctgcg gcggcgcgaa tagcacgttt accgtgaacg tcacgcatgc cggcggtacc       840
     caattacgca gcgacaagtc cggctggcaa tccatcgacg cgagcactgc gcaactgaac       900
     gtgagttgtc tcgaaacatt cggcgacgta gccggttccg gcggtagcgc caacggcaac       960
     atcaccagtt tcatgacgaa tccgcccttc gccgcgtggc aggactggca aggctacggc      1020
     ggctacttca acttcggtta ccagggcagc ctgacaccgg gatggcaagt gcccgaagcg      1080
     atggcccacc agttctccgt gggccccggc ccctcgctcg acccggctaa cggcggcttg      1140
     ctgccctatc aggaagtcaa cggcgcccgc cctggcagcg aggcgccacg catcaccatc      1200
     gaagtcacgc gcaatagcga cacgctggtg aagaccatag gcctgcaggg cggcgggcga      1260
     atggcggttg ccgacaatgc ggcaggcggg gcaatgcgcg cgctctccag cgccaatgcc      1320
     tattttgtgc ggccagacga gacctccatt ggcggctcga tcatgggcgg cttgctgaac      1380
     ggcagccaat gggcgcgcgc ggatcacgcc accgagtatc cgagcctctt cagcccctac      1440
     tggcaagcga gacttgcacc ggtcagcgac gaagagcgcg ctgccgcaca agcaagccag      1500
     atgtccgcag caacgcaggt gcagaaacca tga                                   1533
//

If you have problems or comments...

PBIL Back to PBIL home page