(data stored in ACNUC7421 zone)

EMBL: CP000271.PE113

CP000271.PE113       Location/Qualifiers
FT   CDS_pept        complement(127591..127824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2914"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2914"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33081"
FT                   /db_xref="GOA:Q13S58"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S58"
FT                   /protein_id="ABE33081.1"
FT                   /translation="MTEYIIIVALIAVSAIGVYSLFGQTLRNQTSGLAIEMSGQDAKSN
FT                   ISTAQTNANTATSNANHTKNMGTYNDSNNTGN"
     atgaccgaat acatcatcat cgtcgccctg atcgccgtgt cggcaatcgg cgtgtattcg        60
     ctgttcggcc agacgctgcg taaccagacc tccggcctcg cgatcgaaat gtccggtcag       120
     gacgccaaga gcaatatctc gacggcgcag accaacgcga acacggcaac gagcaacgcc       180
     aaccacacga agaacatggg tacgtataac gacagcaaca acacgggcaa ctaa             234
//

If you have problems or comments...

PBIL Back to PBIL home page