(data stored in SCRATCH zone)

EMBL: CP000271.PE114

CP000271.PE114       Location/Qualifiers
FT   CDS_pept        complement(127841..128110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2913"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2913"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33082"
FT                   /db_xref="GOA:Q13S57"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S57"
FT                   /protein_id="ABE33082.1"
FT                   /translation="MRVQTHLPIRGVACGIAPLILINFATLRSQQILILRPTPLPVGFE
FT                   RWVAFFISVQDTRGRKVVSRHYQIVHLTFFQVRDYENFSNPSQK"
     atgcgggttc aaacccacct cccgatacgc ggcgtcgcat gcggaattgc gccgttgatc        60
     ctcataaact tcgcaaccct aagaagtcaa cagattctta tactccgccc gacaccattg       120
     cccgtgggtt ttgaacggtg ggttgcgttt tttatttctg ttcaagacac gagaggtcgc       180
     aaagtcgtgt ccaggcacta ccagatcgtc cacttaacct tttttcaagt aagagactat       240
     gaaaatttct caaatccgtc gcaaaaataa                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page