(data stored in ACNUC7421 zone)

EMBL: CP000271.PE12

CP000271.PE12        Location/Qualifiers
FT   CDS_pept        13151..13630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3017"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3017"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32980"
FT                   /db_xref="InterPro:IPR009783"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SF9"
FT                   /protein_id="ABE32980.1"
FT                   /translation="MTDPIETRPPLPPFTRETAIQKVRAAEDGWNTRDPERVSLAYTKD
FT                   SVWRNRAEFTNGRAEIVGLLRRKWAKELDYRLIKELWAFTDNRIAVRFAYEWHDDSNNW
FT                   FRSYGNENWEFDEHGLMARRHASINDMPIREADRLYHWPLGRRPDDHPGLSDLGL"
     atgaccgatc cgatcgaaac ccgtccgccg ctgccgccat tcacacgcga aaccgccatc        60
     cagaaagtgc gcgccgcgga agacggctgg aatacccgcg accccgagcg cgtgtcactc       120
     gcctacacaa aagacagcgt atggcgcaac cgtgccgagt tcacgaatgg tcgcgcggag       180
     atcgtcggcc tgttgcggcg caaatgggcg aaagagctcg actaccgtct gatcaaggaa       240
     ctgtgggcgt tcaccgataa ccgcattgcg gtgcgctttg cctacgaatg gcacgacgat       300
     tcgaacaact ggttccgctc gtacggcaac gagaactggg aattcgacga acatggactg       360
     atggcgcgcc gtcatgccag catcaacgat atgccgatcc gcgaagccga ccgcctttat       420
     cactggccgc tcggccgccg ccctgacgac catccgggcc tgtccgatct cggtctctga       480
//

If you have problems or comments...

PBIL Back to PBIL home page