(data stored in SCRATCH zone)

EMBL: CP000271.PE120

CP000271.PE120       Location/Qualifiers
FT   CDS_pept        141407..142525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2907"
FT                   /product="outer membrane protein, OmpA/MotB family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2907"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33088"
FT                   /db_xref="GOA:Q13S51"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S51"
FT                   /protein_id="ABE33088.1"
FT                   /translation="MKYSLIAIALVAMLAGCSSSTTRDQLQIQDPTVLQNGFSATQSQA
FT                   AGAVTPQWIATYGGAKNGAMLSAVQTRLNALGERKNNYFGDKAQCWLNAAAEERSSHDG
FT                   WGFVEEALSQANRLTTALESGQGLSADNPELRTASVLRPDLWKQVLAVKTSPLFPQCQE
FT                   AQRLTACSEVELIHAGHEAWTRDFDESKRLVDGVEKGMPGVAAALEACTPPPVAATVPA
FT                   VPQKMTLQADATFRFDRGDLAGMLPAGKAKLDELVRNLKQADDVTSIRIDGYTDRLGSD
FT                   SYNRQLSAKRAETVKRYLLSGGVTAPISARGRGKEDPVVQCNDHNREALIACLAPNRRV
FT                   ELDFVRAGARTSALPQNQRTQDQPELQGQQEH"
     atgaagtatt cgttaattgc catcgcgctt gtcgcgatgc tcgcaggatg ttcgtcgtcc        60
     acgacgcgcg accagctgca gattcaggat cccaccgttt tgcagaatgg gttcagcgcg       120
     acgcagagcc aggccgcggg agccgtcacg ccgcagtgga tcgccacgta tggcggcgcc       180
     aaaaacggcg cgatgttgag cgccgtgcag acccgtctga atgcactggg tgagcgcaag       240
     aacaactatt tcggcgacaa ggcgcaatgt tggctcaacg ctgccgccga ggaacgctcc       300
     agtcacgacg gctgggggtt tgtcgaagaa gcattgagcc aggctaatcg cctgaccacc       360
     gcgctggaaa gcggccaggg tctttccgcg gacaatccgg aattgcggac cgcttcggta       420
     ctccggccgg atttgtggaa gcaggttctg gcggtaaaga cgtcgccgct gtttccgcaa       480
     tgccaggaag cgcagcgtct gacagcatgt tctgaagtcg agttgattca cgccggccat       540
     gaggcgtgga cgcgtgactt tgatgagagc aagcgtctgg tggatggtgt cgaaaaaggc       600
     atgcctggcg tcgcagccgc cctggaggct tgcacgccgc cgccagtcgc cgcgacggtc       660
     ccggcggtcc cgcaaaaaat gacgctgcaa gccgacgcga ctttcaggtt cgatcggggc       720
     gacctcgccg gcatgctgcc agccggtaaa gccaagctcg atgaactggt ccgcaacctc       780
     aagcaggctg acgacgtgac gagcatccgc attgatggct atacggaccg actcggcagc       840
     gacagctaca accgtcaact gtcggccaag cgcgcggaga ctgtaaagcg ttacctgctg       900
     agcggcggtg ttaccgcgcc gatctcggca cgcggtcgcg gcaaggaaga tccggtggtg       960
     cagtgtaacg accacaaccg cgaggcgctg atcgcctgtc tcgcgccgaa ccgtcgtgtc      1020
     gaactggact ttgtgcgcgc aggggcgcgg acctcggcac tgccgcagaa ccagcggacg      1080
     caggatcaac ccgaactgca aggtcagcag gaacattga                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page