(data stored in ACNUC7421 zone)

EMBL: CP000271.PE122

CP000271.PE122       Location/Qualifiers
FT   CDS_pept        143502..144521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2905"
FT                   /product="Hpt domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2905"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33090"
FT                   /db_xref="GOA:Q13S49"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S49"
FT                   /protein_id="ABE33090.1"
FT                   /translation="MNPVSLSRSSSCTWNQTLGDLLDDSPLESRAFVLDETVTNLREVI
FT                   HGVVALLTPLAHRRDLRLRACVDQSVAETIRTDAARLGQLVFHLLNRTIQLTTHGEISL
FT                   AVRAQPVNLGSQRIYVSVVDTAVKFAPNALPPHPGPAIEDPQMARWLGDANACLPLCRI
FT                   LAQRMGGKLSVSSGTGEGPRAIFDAPFGVEQWAPSAETARGNVQASAFSSAAAQPREIS
FT                   ASDSFEPFDSRYLDALTEEGVDLQVFLNNWRDAMNEDLEQLSGLLREGRFDHLHDVLHR
FT                   LSGAVGLVGASSLMEALRRASTPPEEHSAASVEALLVRAKTLVTQLETTSRAYRSPSQ"
     atgaaccctg tgagcctgtc tcgttcttct tcgtgtacat ggaaccaaac gctcggtgat        60
     ctgctggacg actcaccact ggaatctcgc gctttcgttc tcgacgagac tgtgacgaac       120
     ctgcgtgaag tcatccacgg tgttgttgca ctgcttaccc cgcttgcaca tcgtcgcgat       180
     ttgcgtttgc gcgcatgtgt cgatcaatcg gtggccgaaa cgattcggac cgacgctgcc       240
     cggttaggcc aactcgtttt ccatttgctc aaccgaacaa tccaactcac cacgcacgga       300
     gagatttcgc ttgcggtgcg ggcgcagccc gtgaatttgg gctcgcagcg aatttatgtc       360
     agcgtagtcg atacggccgt aaagttcgcg cccaacgcat tgccgccaca tcctggccca       420
     gccattgaag atccacagat ggccagatgg ctcggcgacg ccaacgcgtg tttgccgctc       480
     tgccggatac tggcccagcg tatgggtggc aagctctccg tttcgagcgg aaccggcgaa       540
     ggcccgagag caatctttga cgcgccgttc ggcgtcgaac agtgggcgcc atccgcggaa       600
     acggctcgcg gcaacgtaca ggcatccgcg ttttccagtg ccgccgcgca gccacgtgaa       660
     atttccgcga gcgactcctt tgagcctttt gacagtcgtt atctggacgc attgactgaa       720
     gaaggggtcg atctccaggt gtttctcaac aactggcgcg acgccatgaa cgaagacctc       780
     gagcaactca gcggcttgct tcgtgaaggt cgattcgatc atctgcatga tgtgctgcac       840
     cggttgagtg gagcggtagg tctcgtcggc gcgagcagtt tgatggaggc gttgcggcgc       900
     gcgagtacgc cgccagagga acacagcgcg gcctcagtcg aagcactgct ggtgcgagcg       960
     aaaaccctcg tcacgcaact tgaaacaacg tcgcgcgcat accggagccc ttcgcaatga      1020
//

If you have problems or comments...

PBIL Back to PBIL home page