(data stored in SCRATCH zone)

EMBL: CP000271.PE123

CP000271.PE123       Location/Qualifiers
FT   CDS_pept        144518..145525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2904"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2904"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33091"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S48"
FT                   /protein_id="ABE33091.1"
FT                   /translation="MNRPLALIEGDLALPIARPFDALPPPFGSRRRPVQTAAQPEPQAR
FT                   SRTAAQQAIQHAVQRREPGARRGPFPPGVKFLLFYKLPQQRDHSRRFDEQLAEARYYLE
FT                   TGRVRPRSTRSDHVLGAAIFAGCGIALAWLLATCTTHNADKAATAIARSAAVRPPAEFA
FT                   GTIAQSEPSAAHSAPKAAVSEAPASANATPGAVFGNVPTPEPQRAEHLVPRPSARVSAD
FT                   QTAPSRPAKANHEPSIARLSKPHVDGRLASSRMTNPATQPSASKSAEWTARSSSANETA
FT                   GRAALFDWAAQQRRAAMTTRAGMPAPGDTDWTARMTQRRITDNPDAFETARSTK"
     atgaaccgac cgttggcctt gatcgagggc gacctggcgc ttccgatcgc gcggccgttc        60
     gatgcgttgc cgccgccctt cggctcacgg cgccggcctg tgcaaaccgc agcgcaaccg       120
     gaaccgcaag ccaggtcacg caccgcggcg caacaggcaa ttcagcatgc agtacaacgc       180
     cgggagccag gggcacgccg tgggccgttt ccaccgggcg tgaagttcct tctgttctac       240
     aagctaccgc aacaacgcga ccattcgcgt cgcttcgacg agcaattggc cgaagcccgg       300
     tactacctgg agacgggccg cgtgcgcccc cgttcgaccc gttcggatca tgtcctcgga       360
     gctgcgattt tcgcgggctg cggcattgcg ctggcctggt tgctggccac ctgcacgacg       420
     cacaacgccg acaaggcagc cacggcgatc gcaaggtcgg cggcggttcg tccgccagct       480
     gaatttgcag gcacgattgc gcagagcgaa ccatcggcag cccattcagc accgaaggcg       540
     gcggtttccg aagcgcctgc gtcggctaac gcgacgccgg gggcggtgtt tggcaacgtc       600
     cctacgcctg agccacaacg tgccgaacac ctcgtgccgc gtccgtccgc gcgagtgtcc       660
     gcggatcaga ctgcgccgag ccggcccgca aaggccaatc atgagccttc aatcgcgcgc       720
     ttgagcaaac cgcacgtcga cgggcgtctc gcatcgagcc gcatgaccaa cccggccacg       780
     cagccttccg cgtcgaagtc ggccgaatgg accgcacgct cctcgtccgc gaacgaaaca       840
     gccgggcgcg cggcactgtt cgactgggcc gcgcagcaac ggcgcgcggc aatgacgacg       900
     cgcgccggca tgcccgcgcc gggtgacacc gactggaccg cccgcatgac ccagcgcagg       960
     atcaccgaca accctgacgc gttcgaaaca gcccgcagca cgaagtag                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page