(data stored in ACNUC7421 zone)

EMBL: CP000271.PE126

CP000271.PE126       Location/Qualifiers
FT   CDS_pept        complement(149871..150377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2901"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2901"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33094"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S45"
FT                   /protein_id="ABE33094.1"
FT                   /translation="MKKLMIAAVIGALSTTMLSVATDAVAQTATTTKPATKAVPKKPQP
FT                   KRLIKRKPNPAKEAKVDPVPEGAEKWSCNEGLAFELKGDMKRDQIVTVHWANKNYNLPR
FT                   EATTTGADRFHDAATGMDLVVIPTKAMLFSDKDSSRLADECKTAAMIEGAPAPTQSNAI
FT                   NKTSN"
     atgaaaaagc tgatgatcgc cgccgtgatt ggcgccctgt ccacgacgat gctgtccgtc        60
     gcgactgacg ccgtcgcaca aacggcgacc accacgaagc cggctaccaa ggctgtgccg       120
     aaaaagccgc agccgaagcg cctgatcaag cgcaaaccga acccagccaa ggaagcgaag       180
     gtcgatccgg tgccggaagg cgcggaaaag tggtcgtgca acgaaggcct ggcgttcgaa       240
     ctgaagggcg acatgaagcg tgaccagatc gtcacggttc actgggctaa caaaaattac       300
     aatctgccgc gcgaagcgac caccacgggt gcagaccgct tccacgacgc cgcaaccggt       360
     atggatctcg tcgtgattcc gaccaaggcc atgttgttct cggacaagga cagctcgcgt       420
     ctggccgacg agtgcaagac ggcagccatg atcgaaggtg caccggctcc gacgcaatcg       480
     aacgcgatca acaagaccag caactaa                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page