(data stored in ACNUC7421 zone)

EMBL: CP000271.PE13

CP000271.PE13        Location/Qualifiers
FT   CDS_pept        13842..14360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3016"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32981"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SF8"
FT                   /protein_id="ABE32981.1"
FT                   /translation="MHFRQINKNIRRAALALVASLAAASAAHAGNWCEGGVWVDAMLGS
FT                   YHINPDPDTHFEQFNPGLGVECWLNNQWALTAGGFRNSLRRPSYYGGGVWAPEFAHWGI
FT                   VRIAAIGGIISGYNYGNWGLGRNHTIGPVVAPIVMVEYKRVGANFIVIPPIPSDDLPFT
FT                   IGFQLKVKF"
     atgcattttc ggcagatcaa caagaacatc cgacgcgcgg cacttgcgct tgttgccagc        60
     ctggccgcgg cgtccgccgc gcacgcaggc aactggtgcg aaggcggcgt atgggtcgac       120
     gccatgctgg gttcgtatca catcaacccg gacccggaca cccatttcga acagttcaac       180
     ccgggactcg gcgtcgaatg ctggctcaat aaccaatggg cgctgactgc cggcggcttt       240
     cgtaattcac tgcgccggcc ttcgtattac ggcggcggtg tgtgggcgcc ggagttcgcg       300
     cattggggca tcgtgcggat cgcggcgatc ggcgggatca tctcgggata taactacggc       360
     aactggggtt tgggccgcaa tcatacgatc ggcccggtgg tcgcgccgat cgtcatggtc       420
     gaatacaagc gggtgggtgc gaacttcatt gtgattccgc cgatcccatc ggatgatctt       480
     ccgtttacga tcgggtttca gttgaaggtg aagttctag                              519
//

If you have problems or comments...

PBIL Back to PBIL home page