(data stored in ACNUC7421 zone)

EMBL: CP000271.PE130

CP000271.PE130       Location/Qualifiers
FT   CDS_pept        complement(154106..154465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2897"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2897"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33098"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S41"
FT                   /protein_id="ABE33098.1"
FT                   /translation="MSNKGLRVFSEAVPCSAATHRQPLCTMLFPRSSGFDFAAIRWPDA
FT                   CRNALFAGARIVQRLPGAVRMCHPAPTRLYRFPAWRSCRNAPLGLGRLRGSPRTVISAV
FT                   FHNASLNAHIEWRFP"
     ttgtcgaaca agggtttgcg ggttttttcg gaggctgttc catgcagcgc cgcgacgcac        60
     cggcagccac tctgcaccat gctgttccca cgcagttcag gtttcgattt cgccgccatt       120
     cgttggccag acgcttgccg aaacgcgctg tttgcaggag cccgcatcgt gcagcggcta       180
     cctggcgctg tgcgcatgtg tcatcccgct cccacacggt tgtacaggtt tccggcatgg       240
     cggtcttgcc gcaacgcgcc gctcggcctc ggcagattac gaggcagtcc gcgaacagtg       300
     atttccgccg tgtttcataa cgcttcgctg aacgcgcata tagaatggcg ttttccctag       360
//

If you have problems or comments...

PBIL Back to PBIL home page