(data stored in ACNUC7421 zone)

EMBL: CP000271.PE132

CP000271.PE132       Location/Qualifiers
FT   CDS_pept        155541..155954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2895"
FT                   /product="succinate dehydrogenase subunit C"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2895"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33100"
FT                   /db_xref="GOA:Q13S39"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S39"
FT                   /protein_id="ABE33100.1"
FT                   /translation="MAEAVKKPRPEFRNIGIGQILTAYRLPLAGRVSILHRLSGGLLFV
FT                   FLPFLLYLFDQSLTSELSFEVFKGFLSNIIVKLITLVLAWAFLFHFCAGIRHLVMDTHR
FT                   AVTKEGGKQTSVVVLVVSSLLTIAFALKLFGAF"
     atggctgaag ccgtaaaaaa accgaggccg gaattccgga acatcggtat cgggcagata        60
     ttgacggcat accgtctccc tctagcgggg cgagtatcca tcttgcaccg cttgagcggt       120
     ggtctgcttt ttgtttttct tccgttcctg ctgtacctct tcgatcagag tctgacttct       180
     gaactcagtt tcgaagtctt caaaggtttt ctctccaaca tcatcgtcaa gctcatcacg       240
     ctcgttctcg cgtgggcctt cctgtttcac ttctgcgccg gcatccgcca cctggtgatg       300
     gacacgcacc gcgcggtgac gaaagagggt ggcaagcaaa cttccgtcgt cgttctggtc       360
     gtttcgtcgc tcctgacgat tgcatttgcg ctcaaactct tcggagcatt ctaa             414
//

If you have problems or comments...

PBIL Back to PBIL home page