(data stored in SCRATCH zone)

EMBL: CP000271.PE133

CP000271.PE133       Location/Qualifiers
FT   CDS_pept        155959..156327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2894"
FT                   /product="succinate dehydrogenase subunit D"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2894"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33101"
FT                   /db_xref="GOA:Q13S38"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S38"
FT                   /protein_id="ABE33101.1"
FT                   /translation="MAANNRIGPKRLVVGAHYGLRDWLAQRITACVMAIYTVILLVWFF
FT                   GARDFSYEGWSSIFATQWMKLATFVTLLSLFYHAWVGIRDIWMDYVKPVGTRLFLQALT
FT                   IVWLLACAGYAAQILWRV"
     atggcagcta ataaccgaat cggtccgaag cgtctcgtcg tcggcgcaca ttacggtctg        60
     cgcgactggc tcgcccagcg cattactgcc tgcgtgatgg cgatctacac ggtaatcctg       120
     ctcgtctggt tcttcggcgc gcgcgatttc tcgtatgaag gctggtcgtc gatcttcgcg       180
     acgcaatgga tgaaactcgc cacgtttgtc acgctgctct cgctgttcta tcacgcgtgg       240
     gttggtatcc gcgacatctg gatggactat gtgaagcccg ttggcacgcg cctgttcctt       300
     caggcgctga cgatcgtctg gctgctcgca tgtgcgggct acgctgcgca gattctctgg       360
     agagtgtaa                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page