(data stored in SCRATCH zone)

EMBL: CP000271.PE134

CP000271.PE134       Location/Qualifiers
FT   CDS_pept        156332..158107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2893"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2893"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33102"
FT                   /db_xref="GOA:Q13S37"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S37"
FT                   /protein_id="ABE33102.1"
FT                   /translation="MAAIKNSLPRRKFDVVIVGAGGSGMRASLQLARAGLSVCVLSKVF
FT                   PTRSHTVAAQGGIGASLGNMSEDNWHYHFYDTIKGSDWLGDQDAIEYMCREAPNAVYEL
FT                   EHFGMPFDRNADGTIYQRPFGGHTANYGEKPVQRACAAADRTGHALLHTLYQQNVAAKT
FT                   QFFVEWMALDLIRDAEGDVLGVTALEMETGDVYILEGKTTLFATGGAGRIFAASTNAFI
FT                   NTGDGLGMAARSGIALQDMEFWQFHPTGVAGAGVLITEGVRGEGGILRNSNGERFMERY
FT                   APTLKDLAPRDFVSRSMDQEIKEGRGVGPNKDHVLLDLSHIGAETIMKRLPSIREIALK
FT                   FANVDCIKEPIPVVPTIHYQMGGIPTNIHGQVVGTSKGAEDPVNGFYAVGECSCVSVHG
FT                   ANRLGTNSLLDLVVFGRAAGNHIVKHVKEIKEHKPLPADAADFALSRLAKLDSSSSGEY
FT                   AQSVANDIRGTMQKHAGVFRTSALLAEGVERIREVADRVDNIHLKDKSKVFNTARIEAL
FT                   EVANLIEVARATMVSAEARKESRGAHAQDDFEHRDDENWLRHTLWFSKGDRLDYKPVHM
FT                   QPLTVESVPPKARTF"
     atggctgcaa tcaagaattc tctgccgcgt cgcaagtttg acgtggttat cgtcggcgca        60
     ggcggctcgg ggatgcgcgc ttcgctgcaa ctcgcgcgcg ccggtctgtc ggtctgcgtg       120
     ctgtccaaag tgttcccgac gcgttcgcac acggttgctg cccagggcgg catcggcgct       180
     tcgctcggca acatgagcga agacaactgg cactatcact tctacgacac gatcaagggt       240
     tccgactggc tcggcgacca ggacgcgatc gagtacatgt gccgcgaagc gccgaacgca       300
     gtctacgaac tcgaacactt cggcatgccg ttcgaccgta atgcagacgg cacgatttac       360
     caacgcccgt tcggcggcca taccgcgaac tacggcgaaa agccggtgca acgcgcttgc       420
     gcggccgccg accgtaccgg tcacgcgctg ctgcacacgc tgtaccagca gaacgtggcg       480
     gccaagacgc agttcttcgt cgaatggatg gcgctcgacc tgatccgcga cgccgaaggc       540
     gacgtgctcg gcgtgaccgc gctggaaatg gaaaccggcg acgtctacat tctcgaaggc       600
     aagaccacgc tgttcgccac gggcggcgcg ggccgcattt tcgcggcttc cacgaatgca       660
     ttcatcaaca cgggtgacgg cctgggcatg gccgcgcgtt cgggcatcgc actgcaagac       720
     atggaattct ggcaattcca ccccaccggc gtggccggcg cgggcgtgct gattaccgaa       780
     ggcgtgcgcg gcgaaggcgg cattctgcgc aactcgaacg gcgagcgttt catggaacgc       840
     tacgcgccta ctttgaagga tctggcgccg cgcgacttcg tgtcgcgttc aatggaccag       900
     gaaatcaagg aaggccgcgg cgtgggtccg aacaaggatc acgtgctgct cgacctgtcg       960
     cacatcggcg ccgagacgat catgaagcgt ctgccgtcta tccgcgaaat cgcgctgaag      1020
     ttcgcgaacg tcgattgcat taaagagccg atcccggtcg tgccgaccat ccactatcag      1080
     atgggcggta ttccgacgaa cattcacggc caggtggtgg gcacgtcgaa gggcgcggaa      1140
     gatccggtca acggtttcta cgcagtgggc gaatgctcgt gcgtgtcggt gcatggtgcg      1200
     aaccgtctcg gcacgaactc gctgctcgac ctggtggtgt tcggccgcgc ggccggcaac      1260
     cacatcgtca agcacgtgaa ggaaatcaag gagcacaagc cactgccggc cgacgccgct      1320
     gatttcgcac tgtcgcgtct ggctaagctc gatagctcgt cctcgggcga gtacgcgcaa      1380
     tcggtcgcga acgacattcg cggcacgatg cagaagcacg ccggtgtgtt ccgtacctcg      1440
     gcgttgctgg ctgaaggcgt cgagcgcatc cgcgaagtgg ccgaccgcgt cgacaacatc      1500
     catctgaagg acaagtcgaa ggtgttcaac acggcgcgta tcgaagcgct ggaagtggcg      1560
     aacctgatcg aagtggcacg cgccacgatg gtttccgccg aagcgcgcaa ggaaagccgt      1620
     ggcgcgcacg cgcaggacga cttcgaacat cgcgacgacg aaaactggct gcgccatacg      1680
     ctgtggttca gcaaaggcga tcgcctcgac tacaagccgg ttcacatgca accgctgacg      1740
     gtcgaatcgg ttccgccgaa agcgcggacc ttctaa                                1776
//

If you have problems or comments...

PBIL Back to PBIL home page