(data stored in ACNUC7421 zone)

EMBL: CP000271.PE135

CP000271.PE135       Location/Qualifiers
FT   CDS_pept        158132..158836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2892"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2892"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33103"
FT                   /db_xref="GOA:Q13S36"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S36"
FT                   /protein_id="ABE33103.1"
FT                   /translation="MAKRTFEIYRYDPDKDAAPRMQTYEIEIDSHERMLLDALLKLKAM
FT                   DETLSFRRSCREGVCGSDAMNINGKNGLACLTNLNDLPQKIVLRPLPGLPVVRDLICDF
FT                   TQFFNQYHSIKPYLINDTPPPEKERLQSPEERDELDGLYECILCASCSTSCPSFWWNPD
FT                   KFVGPAGLLQAYRFIADSRDEATGERLDNLEDPYRLFRCHTIMNCVDVCPKGLNPTKAI
FT                   GKIKELMVRRAV"
     atggcaaagc gtacatttga aatttatcgc tacgacccgg acaaggacgc agcgccgcgc        60
     atgcaaacgt acgagatcga gatcgactcg cacgaacgca tgctgctcga cgcactgctc       120
     aagctgaagg caatggacga gacgttgtcg ttccgccgct cgtgccgtga aggcgtgtgc       180
     ggttcggacg caatgaacat caacggcaag aacggtctgg cgtgcctgac gaacctgaac       240
     gacctgccgc aaaagatcgt gctgcgtccg ctgccgggcc tgcctgtggt gcgcgacctg       300
     atctgcgact tcacgcagtt cttcaaccag taccattcga tcaagccgta tctgatcaac       360
     gacacgccgc cgccggaaaa ggaacgtctg cagtcgccgg aagaacgcga cgagctcgac       420
     ggcctgtacg aatgtatcct gtgcgctagc tgctcgacgt cgtgcccgag cttctggtgg       480
     aatccggaca agttcgtcgg cccggccggc ctgctgcaag cctaccgttt catcgcggat       540
     agccgcgacg aggcgacggg cgagcgtctc gacaacctgg aagatccgta ccgtctgttc       600
     cgttgccata ccatcatgaa ttgcgtcgac gtttgtccga agggcctgaa cccgaccaag       660
     gcgattggca agatcaagga attgatggtt cgccgcgctg tttga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page