(data stored in SCRATCH zone)

EMBL: CP000271.PE136

CP000271.PE136       Location/Qualifiers
FT   CDS_pept        158838..159110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2891"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2891"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33104"
FT                   /db_xref="InterPro:IPR005631"
FT                   /db_xref="InterPro:IPR036714"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S35"
FT                   /protein_id="ABE33104.1"
FT                   /translation="MDDTSHQSDPLRRARLRWRARRGLLENDLIFERFFGRYEHDLSDA
FT                   DVGALTRLLELSDNDLMDLLLARKEPEGDLADPDVVRVLELLRNA"
     atggacgaca catcgcatca gtccgaccct ctccgccgtg cgcgccttcg ctggcgcgca        60
     cggcggggcc tgctggaaaa cgatctgatc tttgagcgtt ttttcggccg atatgagcat       120
     gacctcagcg atgccgacgt gggcgccctc acacgcctgc tcgagctgag cgataacgac       180
     ctgatggact tgctgctcgc gcgcaaggaa ccggaaggcg accttgccga cccggatgtg       240
     gtccgggtgc tggagttgct gcggaatgcc tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page