(data stored in ACNUC7421 zone)

EMBL: CP000271.PE138

CP000271.PE138       Location/Qualifiers
FT   CDS_pept        160825..162234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2889"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2889"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33106"
FT                   /db_xref="GOA:Q13S33"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S33"
FT                   /protein_id="ABE33106.1"
FT                   /translation="MAQTLYDKLWNTHVVHTEEDGTTILYIDRHLLHEVTSPQAFEGLK
FT                   LAERPVWRISANLAVSDHNVPTTDRSHGIADPISRLQVDTLDSNCDAYGITQFKMNDLR
FT                   QGIVHIIGPEQGATLPGMTIVCGDSHTSTHGAFGALAHGIGTSEVEHVLATQTLLQKKS
FT                   KNMLVKVEGALPRGCTAKDIVLAIIGKIGTAGGTGYAIEFGGSTIRALSMEGRMTVCNM
FT                   AIEAGARAGMVAVDDTTIEYLKGRPFSPEGVEWNHAVEYWKQFKSDDGAQFDRVVELNA
FT                   AEIVPQVTWGTSPEMVTAVDGRVPDPDREKDPVKRDALERALKYMALEPNAPIESIKPD
FT                   KIFIGSCTNARIEDIRAAAYVVKKLGRRVAPNIRLAMVVPGSGLVKAQAEREGLDKVFT
FT                   DAGFEWREPGCSMCLAMNADRLEPGERCASTSNRNFEGRQGAGGRTHLVSPAMAAAAAI
FT                   EGHFVDIRKLG"
     atggcacaga ctctctacga caaattgtgg aacacacacg tggtccacac ggaagaagac        60
     ggcacgacga ttctctacat cgaccgtcac ctgctgcacg aagtgaccag ccctcaggcg       120
     ttcgaaggcc tgaagctggc tgagcggccg gtgtggcgca tcagcgcgaa cctcgcggtg       180
     tcggaccata acgtgccgac cacggaccgc agccacggca ttgccgatcc catctcccgg       240
     ctgcaagtcg acacgctcga ttccaactgc gacgcctacg gcatcaccca gttcaagatg       300
     aacgatctgc ggcagggcat cgtgcacatc atcgggccgg agcagggcgc gacgctgccg       360
     ggcatgacga tcgtctgcgg cgactcgcac acgtccacgc acggcgcgtt cggcgcgctg       420
     gcgcacggca tcggcacgtc ggaagtcgag cacgtgctgg ccacgcaaac gctcctgcag       480
     aagaagagca agaacatgct ggtgaaggtg gaaggcgcgc tgccgcgcgg ctgcaccgcg       540
     aaagacatcg tgctcgccat catcggcaag atcggcacgg cgggcggcac gggctatgca       600
     atcgaattcg gcggctcgac catccgcgcg ctttccatgg aaggccgcat gacggtctgc       660
     aacatggcga tcgaggcggg cgcgcgcgcc ggcatggtcg cggtcgacga caccaccatc       720
     gaatacctga agggccgccc gttctcgccg gaaggtgtgg agtggaacca cgcggtcgag       780
     tactggaaac agttcaaatc ggacgacggt gcgcaattcg accgcgtggt cgagctgaac       840
     gccgccgaga tcgtgccgca agtcacgtgg ggcacgtcgc cggaaatggt cacggccgta       900
     gacggccgcg tgccggatcc ggatcgcgag aaggacccgg tcaagcgcga cgccttggag       960
     cgcgcgctga aatacatggc gctcgaaccg aatgcgccga tcgaatcgat caagccggat      1020
     aaaatcttca tcgggtcgtg cacgaacgcg cgtattgaag acattcgcgc cgcggcttac      1080
     gtcgtgaaga aactgggccg ccgcgtggcg ccgaacattc gtctggcgat ggtcgtgccg      1140
     ggttcggggc tcgtgaaggc gcaggcggaa cgtgaaggcc tcgacaaggt ctttaccgac      1200
     gccgggttcg aatggcgtga accaggttgc tcgatgtgtc ttgccatgaa cgccgaccgg      1260
     ctggagccgg gcgagcgttg cgcatccacg tcgaatcgta atttcgaagg tcgtcagggc      1320
     gccggtggcc gtacccacct cgtgagcccc gcgatggctg cggctgcggc tatcgaaggg      1380
     catttcgtcg atattcgcaa gcttggataa                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page