(data stored in ACNUC7421 zone)

EMBL: CP000271.PE139

CP000271.PE139       Location/Qualifiers
FT   CDS_pept        162488..163141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2888"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2888"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33107"
FT                   /db_xref="GOA:Q13S32"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S32"
FT                   /protein_id="ABE33107.1"
FT                   /translation="MEKFIVHTGVVAPLDRENVDTDAIIPKQFLKSIKRTGFGPNAFDE
FT                   WRYLDHGEPGQDNSQRPLNPDFVLNQPRYQGASVLLARKNFGCGSSREHAPWALEQYGF
FT                   RALIAPSFADIFYNNCFKNGVLPIVLTEQQVDHLFNETYAFNGFKLTVDLEAQVVRTAD
FT                   GGTEYPFEVAAFRKYCLLNGFDDIGLTLRHADKIRQFEAERIAKQPWLAHRIVG"
     atggaaaaat tcatcgtaca caccggcgtc gtggcgccgc tcgatcgcga aaacgtcgac        60
     acggacgcga tcattccgaa gcaattcctg aagtcgatca agcgcacggg tttcggtccg       120
     aacgcgttcg acgaatggcg ctacctcgac cacggcgagc cgggtcagga caattcgcag       180
     cgcccgctga atccggactt cgtgctgaac cagccgcgtt atcaaggtgc ttcggtgctg       240
     ttggcgcgca agaacttcgg ctgcggcagt tcgcgtgagc acgcgccgtg ggcgttggag       300
     caatatggct ttcgcgcgct gatcgcgccg agcttcgccg acattttcta caacaactgc       360
     ttcaagaacg gcgtgttgcc gatcgtgctg accgaacagc aagtcgatca cctgttcaac       420
     gaaacgtatg cgttcaacgg cttcaagctg acggtcgatc tcgaagcgca agtcgtgcgc       480
     acggcggacg gcggcaccga atatccgttc gaagtcgcgg cgttccgcaa gtactgcctg       540
     ctgaacggct tcgacgacat cggtctcacg ctgcgtcacg cggacaagat ccgccagttc       600
     gaagcggagc ggatcgcgaa gcagccgtgg ctggctcacc gcatcgtcgg ttaa             654
//

If you have problems or comments...

PBIL Back to PBIL home page