(data stored in ACNUC7421 zone)

EMBL: CP000271.PE141

CP000271.PE141       Location/Qualifiers
FT   CDS_pept        complement(164383..164655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2886"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2886"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33109"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S30"
FT                   /protein_id="ABE33109.1"
FT                   /translation="MSGHDGRSAFRDRFRGNRFNGSFGGNGELNRTGRFAVQFRNRGDL
FT                   SCVRHRYNIHENRNPATSISAVIARIARESASFEANSRFKGRLTT"
     atgagcgggc acgacggacg atcagcgttt cgtgatcgtt ttcggggtaa tcgttttaat        60
     ggaagctttg gcggtaatgg cgagctcaac cgcacgggcc gttttgccgt gcagtttcga       120
     aatcgaggag atttgagctg tgtgcgccat cgctacaata tacacgaaaa ccggaatccg       180
     gcgacgtcaa tatccgccgt tatcgcccgt attgcgcgcg aatcggcctc attcgaggcc       240
     aattcgcgtt ttaaaggccg tttgacgacc tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page