(data stored in ACNUC7421 zone)

EMBL: CP000271.PE143

CP000271.PE143       Location/Qualifiers
FT   CDS_pept        165980..168628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2884"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2884"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33111"
FT                   /db_xref="InterPro:IPR020011"
FT                   /db_xref="InterPro:IPR038440"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S28"
FT                   /protein_id="ABE33111.1"
FT                   /translation="MNLRLSSLRAMFVHRGAGQLMATAALAFALAGAGLGSAVAAPGDA
FT                   ASAPDAAAVSYANGGQVTVRAGQSLNDVAIAVTQSHDRATLARASRALFEANPNAFMSH
FT                   DPSRMRVGAVLTVPVLDASGALAASSAGAASAVSATAATTPASAPGTAVASGPASGVAQ
FT                   VNAAAASAVSAASAAARAATPAAPAVAATASVAAEASSAAPAAVVSSAPLVGSQAAALP
FT                   ASGAHEWAGSIQPSASEPAEGASAPGAATTAGTSAAQPASQPRAQVSSLQQLLALKNRV
FT                   LMELQKHGIGGTPAVTATAPTGVAQPAPGASSAAAAPGHVATPVASTSKDAGMSQTELS
FT                   VAAAVGAALVVLLAALRMGRRKRERVAAAEAVSTEGDSAVSARVTGQQDIASTREEIPV
FT                   HEAPDAADEAAVRNAAALAATEREAAEGEAAAREMAERVAAERDAEIRRAAAREAEEQA
FT                   AERAAEERAAAGRAAEERAAAERVAAEQAAAEHAAEERAAAERAVEEQAAAERAAEQQA
FT                   AAERAAEEQAAAKRATEQQTAAERAAEEQTATERATAEQAATERAAAEHAATQQPASGH
FT                   EATAHATFPTQDPATPQRVWQERDVTSASAEPAQVDPNIAPSAQSDFAPEPLPAPPLDH
FT                   FDDATMAASLAAAAELGAEALPLAPPEPLDEAFPHEEPVHRLQWDDEPAAPQEPLPEPA
FT                   APVHSQPAPTVPTEFPRDAVDAFGSLDMPLPPRVESSADHVHAPASLSTQPMSSQEATA
FT                   KQSAAEHHPDDTPHIADEISAGTAGHAAVAGLGAGLGTGLGAGLGASGFGALKLDFDLE
FT                   LPPGPAEPLPAFTQADLTRIARNKLDLATEYIELGDLSGARALINEVIETNDPATRTEA
FT                   RALLSTLAPLS"
     atgaaccttc gactctcatc ccttcgggct atgttcgttc atcgaggtgc tggccaattg        60
     atggccaccg ccgctttggc ctttgcgctg gccggcgccg ggctgggtag cgcggtcgcc       120
     gcgccgggcg atgccgcaag cgcgccggac gctgctgccg tttcgtacgc gaacggtggt       180
     caagtcacgg tgcgcgccgg gcagtcgctg aacgacgtgg cgattgccgt cacgcagtcg       240
     cacgaccggg cgacgctcgc acgtgcgtcg cgtgcattgt tcgaggcgaa cccgaatgcc       300
     ttcatgagcc atgacccgag ccggatgcgc gtgggcgcgg tgttgacggt gccggtgctg       360
     gatgcgtcgg gtgcgctggc tgcgtcgtcg gcgggtgctg cgtccgccgt ttccgcgacg       420
     gctgctacga cgccggcttc cgcgccgggc acagcggtgg cgagtgggcc ggcgagcggc       480
     gtggcgcagg tcaatgcggc ggcggcaagc gccgtgagtg cggcaagtgc agcggctcgg       540
     gccgcgacgc ctgccgctcc tgccgttgcg gcgacggcca gtgtagctgc cgaggccagt       600
     tcggcggcgc cggcggcggt ggtgtcttct gccccgctcg tgggatcgca ggcggcggcg       660
     ctgccggcga gcggcgccca tgaatgggcc ggatcgattc aaccgtcggc tagcgagcct       720
     gctgaaggcg cttcggcgcc tggcgccgca acaactgcgg ggacgagcgc cgcacagccg       780
     gcatcgcagc cgcgtgcgca ggtctcgagc ctgcagcaat tgctggcgct gaaaaaccgc       840
     gtgctgatgg agttgcagaa gcatggtatc ggcggtacgc cggctgtaac ggccactgcc       900
     ccgaccggcg tcgcgcagcc ggcgccgggt gcgtcctcgg cagcggctgc gccgggtcat       960
     gtcgctacgc cggtggcctc gacgtcgaaa gatgccggca tgtcgcagac ggaactgagc      1020
     gtggcggctg cggttggcgc ggcgctggtg gtgctgcttg cggctttgcg tatggggcgc      1080
     cgcaagcgtg agcgtgtcgc ggcggctgaa gctgtgtcga cggaaggcga ttccgcagtg      1140
     tccgcacggg taacgggcca gcaggacatc gcttcgacgc gcgaggagat tccggtgcac      1200
     gaagcgccgg acgcggccga cgaagcagcc gtacgaaatg cggcagcgct ggcggccacc      1260
     gagcgtgagg ctgcggaagg cgaggcggcg gcgcgcgaga tggcggaacg cgtggcggcg      1320
     gagcgcgacg cggaaattcg ccgggcggcg gcgcgagaag cagaggaaca ggcggcggag      1380
     cgtgcggccg aagagcgagc cgcagcaggg cgagcagccg aagaacgggc tgcggcagaa      1440
     cgcgtggcgg cagagcaggc tgcggcagaa cacgcggccg aagagcgggc tgcggcggag      1500
     cgagcagtcg aagaacaggc cgcagcggaa cgcgcagccg aacagcaggc cgcagcagag      1560
     cgagcagccg aagaacaggc tgcggcgaaa cgcgcaaccg aacagcagac cgcagcagag      1620
     cgagcagccg aagaacagac agcaacggaa cgcgcaacgg cagagcaggc ggcaacggaa      1680
     cgcgcagcgg ccgagcacgc cgcaacccaa caacccgcat ccggccacga agccaccgct      1740
     cacgcaacct tccccacaca agaccccgcc acgccccagc gcgtctggca ggagcgcgac      1800
     gtcacgtccg cgtccgccga acccgcgcaa gtcgatccga acattgcgcc gtccgctcag      1860
     agcgatttcg cgcccgaacc tcttcctgcg ccgccgctcg atcacttcga tgacgcgacg      1920
     atggccgcga gcctcgccgc cgctgcggaa ctcggtgccg aggctttgcc gctggcgccg      1980
     cccgagcccc tcgacgaagc cttcccgcat gaggaacccg ttcaccgtct gcaatgggac      2040
     gatgagcctg ccgcaccgca ggaaccactg cccgaaccgg cagcgccggt gcattcccaa      2100
     cccgcgccca ctgtgccgac cgagtttccg cgcgacgccg tcgatgcctt cggcagcctc      2160
     gacatgccgt tgccaccgcg cgtcgagtcg tccgccgacc acgtgcatgc gcccgcttcg      2220
     ttgtcgacgc agccgatgtc gtcacaggaa gccacggcga aacaatccgc ggccgagcat      2280
     catccggacg acacgccgca catcgccgac gagatctccg ccggcacagc gggccacgcg      2340
     gccgtcgcag gactgggcgc cggcttgggt acaggcttgg gcgcgggcct cggcgcgtcc      2400
     ggcttcggcg cgttgaagct cgacttcgac ctcgagttgc cgcccggccc ggccgagccg      2460
     ctgcccgcgt tcacgcaggc cgatctcacc cgcatcgccc gcaacaagct cgatctggct      2520
     accgagtaca tcgaactcgg cgacctgtcg ggcgcgcgcg ctctcatcaa cgaagtgatc      2580
     gagacgaacg atccggctac gcgcaccgag gcccgcgcgc tgctctcgac gctcgccccg      2640
     ttgtcgtga                                                              2649
//

If you have problems or comments...

PBIL Back to PBIL home page