(data stored in ACNUC7421 zone)

EMBL: CP000271.PE149

CP000271.PE149       Location/Qualifiers
FT   CDS_pept        173263..174135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2878"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2878"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33117"
FT                   /db_xref="GOA:Q13S22"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S22"
FT                   /protein_id="ABE33117.1"
FT                   /translation="MSWLDKLLPPKIKQTDPKNRKGIPEGLWIKCPSCEAVLYRNDVEA
FT                   NLHVCPKCDHHMRIGARERLDGLLDPEGRYEIGQEIVPVDALKFKDSRKYPDRLKEAMD
FT                   DTDETDAMVVMGGAIHTLPVVVACFEFSFMGGSMGSVVGERFVRGAQNALEQKVPFICF
FT                   TASGGARMQESLLSLMQMAKTTAMLTKLAEARLPFISVLTDPTMGGVSASFAFLGDVVI
FT                   AEPKALIGFAGPRVIEQTVREKLPEGFQRAEFLLTKGAIDMIVDRRKLREEIAQLMALL
FT                   SHQPADAVA"
     atgagctggc tcgataaact gctgccgccg aaaatcaaac aaaccgaccc gaagaaccgc        60
     aagggaattc cggaaggcct gtggatcaag tgcccgtcgt gcgaagccgt gctgtaccgc       120
     aatgacgtcg aggccaatct gcatgtttgc ccgaaatgcg accaccacat gcgcatcggc       180
     gcgcgtgagc ggctcgacgg cctgctggat ccggaaggtc gctacgaaat cggccaggaa       240
     atcgtcccgg tcgacgcgct caagttcaaa gacagccgca agtaccccga ccgtctgaaa       300
     gaagcgatgg acgacaccga cgaaaccgac gcaatggtcg tcatgggcgg cgcgatccat       360
     acgctgccgg tggtggtggc ctgcttcgag ttctcgttca tgggcggctc gatgggctcc       420
     gtggtcggcg agcgcttcgt gcgcggcgcg cagaacgcgc tcgaacagaa agtgccgttc       480
     atctgtttta ccgcttcggg cggcgcgcgg atgcaggaaa gcttgctttc gctgatgcaa       540
     atggcgaaga ccacggccat gctgacgaag ctcgccgaag ccaggctgcc gttcatctcc       600
     gtgctgaccg acccgactat gggcggcgta tcggccagtt tcgcgttcct cggcgacgtg       660
     gtgatcgcgg aaccgaaggc gctgatcggc tttgccggcc cgcgcgtgat cgagcaaacc       720
     gtgcgcgaga aattgccgga aggcttccag cgcgccgagt tcctgctgac gaagggcgcg       780
     atcgacatga tcgtcgaccg tcgcaagctg cgtgaagaga tcgctcaact gatggcgctt       840
     ctgagccatc aaccggcaga cgcggtggcg taa                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page