(data stored in ACNUC7421 zone)

EMBL: CP000271.PE15

CP000271.PE15        Location/Qualifiers
FT   CDS_pept        15437..15844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3014"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32983"
FT                   /db_xref="InterPro:IPR036696"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SF6"
FT                   /protein_id="ABE32983.1"
FT                   /translation="MSAKLNEASRRVAENCAQRSHNGTIDFGSVVRALGEAGVESYFTD
FT                   YRRGEHTYYAPSGETHVIALPLPDTAIANAFDADAVNQAVRGAQSGAVKYAEFVSRTLA
FT                   AGCVGYFVWIAGRQVQYFGRRGEIHVERFPQ"
     atgtccgcaa agctcaatga agcaagccgc cgcgtcgccg aaaactgtgc gcagcgctcc        60
     cacaacggta cgatcgactt cggctcggtg gtgcgtgcgc tcggtgaggc tggcgtcgaa       120
     tcgtatttca ccgattatcg tcgtggcgag catacgtact acgcgcccag cggcgagacg       180
     cacgtgatcg cattgccgct gccggacacc gccattgcga acgcattcga cgccgatgct       240
     gtgaaccagg ccgtgcgcgg cgcacaaagc ggcgcggtca aatacgcgga gttcgtgagc       300
     cgaaccctgg cggcaggatg cgtcggctat ttcgtctgga tcgcgggacg ccaggtgcag       360
     tatttcggcc ggcgcggcga gattcacgtg gagcgctttc cgcaatga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page