(data stored in SCRATCH zone)

EMBL: CP000271.PE151

CP000271.PE151       Location/Qualifiers
FT   CDS_pept        175771..176709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2876"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2876"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33119"
FT                   /db_xref="GOA:Q13S20"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S20"
FT                   /protein_id="ABE33119.1"
FT                   /translation="MGIFSFGKKDDAPTRRGANTSSTRAARGERVERRTRRTERTVDAD
FT                   AMLLDPTLPEKQRARRRLVGAIAMVVAAVVILPMVLDSHPKPVTDDISIDIPSRPAPKL
FT                   AKAEEDTQAGVAPDNPTPDAALAASGLAPATAARQGQSAATKPPGADTNAAAPAARPAV
FT                   KPQAPSVAANTTPVAPAAPAKPAKPPVTHNAATAPAPATPAPTAQAPSSDDTNAAAGAD
FT                   ANSGTPASPPGSRFAVQLGAFANDTNARNWAAKLKAAGVPAYTEHRKQADGSTLTLLRA
FT                   GPFADRAAASAAIAKVREAGLMSGANSGAAQ"
     atgggaattt tctcgttcgg caagaaagac gacgcgccca cccggcgcgg cgcaaacacc        60
     agttccaccc gggccgcccg tggcgagcgc gtggagcggc ggacccgccg cacggagcgc       120
     accgtcgacg ccgatgcgat gctgctcgac cctacgttgc cggaaaagca gcgagcgcgt       180
     cgccgcctgg ttggcgcgat cgcaatggtc gtggccgcgg tcgtcatctt gccaatggtg       240
     ctggactcgc atcccaagcc cgttacagac gacatttcca tcgacattcc aagccgcccc       300
     gcgccgaaac tcgccaaagc cgaggaagac acgcaggccg gtgtagcacc cgacaatccc       360
     acgcccgacg cggcactcgc ggcatccggt cttgcgccgg ccacggcagc gaggcaaggg       420
     cagtccgccg ccacgaagcc gccgggcgcg gacacgaacg cagcagcgcc cgcggccagg       480
     ccggcggtga aaccgcaggc accgtccgtc gccgctaaca ccacgccagt ggcgcccgca       540
     gcgcccgcca agccggccaa accgccggtc acgcacaacg ccgcgaccgc tcccgcaccg       600
     gccactccgg cgccgaccgc tcaggcaccc agttccgacg acacaaacgc ggccgccggc       660
     gcggacgcga attccggcac gccggcgtcg ccgccgggca gccgtttcgc cgtgcaactc       720
     ggcgcgtttg caaacgacac caacgcgcgt aattgggccg ccaagttgaa agcggcgggc       780
     gtgcccgcat ataccgagca tcggaagcag gctgacggtt ccacgctcac gttgctgcga       840
     gccggcccgt tcgccgatcg tgcagcggca agcgccgcca ttgcaaaggt tcgcgaggcc       900
     ggcttgatgt cgggcgcgaa cagcggcgcc gcacagtaa                              939
//

If you have problems or comments...

PBIL Back to PBIL home page