(data stored in SCRATCH zone)

EMBL: CP000271.PE152

CP000271.PE152       Location/Qualifiers
FT   CDS_pept        176717..177211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2875"
FT                   /product="Putative bacteriocin production related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2875"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33120"
FT                   /db_xref="GOA:Q13S19"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S19"
FT                   /protein_id="ABE33120.1"
FT                   /translation="MFTAFDYAVMAVIGLSALRGTWRGFLSEIFGLIGWIAAFFIACRF
FT                   VGYVVPLIPSNWPGGALTQWLLAFALVVIGVVLVASVLNALLSRIVQATGLSGVDRSLG
FT                   LMFGLVRGVILVLILVALAGLTELPQQEFWRNALLRPYAVEGVHVMKPLLPETLAAYVR
FT                   V"
     atgttcactg ccttcgacta cgctgtaatg gcggtgatcg gtttgtcggc gctgcgcggc        60
     acatggcgcg ggtttttgtc ggaaatattc gggctgatcg gctggattgc ggcgtttttc       120
     attgcttgcc gcttcgtggg ttatgtcgtg ccgttgatcc cgtccaactg gccgggcggc       180
     gcgttgaccc agtggctgct ggccttcgcg ctggtggtga tcggtgtggt gctggtggcg       240
     agcgtgttga acgccctgtt gagccgcatc gtgcaggcaa ccggcttgag cggcgtggac       300
     cgctcgctcg gtttgatgtt cggcctcgtg cgcggggtca ttctggtgct gattctggtc       360
     gccctggctg gcttgaccga actgccccaa caggaattct ggcgcaacgc cttgcttcgg       420
     ccctatgcgg tcgagggcgt gcacgtaatg aaaccgctgc ttcccgagac gctggctgct       480
     tacgtccgag tgtga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page