(data stored in ACNUC7421 zone)

EMBL: CP000271.PE157

CP000271.PE157       Location/Qualifiers
FT   CDS_pept        181921..182727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2870"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2870"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33125"
FT                   /db_xref="GOA:Q13S14"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S14"
FT                   /protein_id="ABE33125.1"
FT                   /translation="MTTSSTGNAGEKPVPSGFAVSGRTALLRAETALFMRDHVLSLVSH
FT                   DLRGPLNAIHSWAYVLERKLDANDPNAQRAVTGIRNGVDQQVKLLETIVDATRAETKSL
FT                   VLAYAPFSLHPLLEETVEEVRSGLGRARGVEVTVDSQLATEQLNGDRERLAAALWLMLM
FT                   FAVETGAEGATVTLVTKADTNAWHASVGYEANGTALDDPALPHVLEAFARKQAREPREA
FT                   KRIAWVLALCKRVAEAHGGSFEQVDATGSDTATLALRVPLSATAAK"
     gtgacaacgt cttcaaccgg aaatgctggc gaaaagccgg tgccttccgg cttcgccgta        60
     tctggacgca ccgcgcttct gcgcgcggaa accgcactgt tcatgcgtga ccatgtgctg       120
     tcgctggtgt cgcacgacct gcgtggtccg ttgaatgcca ttcatagctg ggcgtacgtg       180
     ctggagcgca aactcgacgc gaacgacccc aacgcgcagc gcgccgtcac cggtattcgc       240
     aatggcgtgg atcagcaggt caagctactc gagacgattg tcgacgccac gcgcgccgag       300
     accaaatcac tggtgcttgc ctacgcgccc ttttccctgc atccgttact cgaagaaacg       360
     gtggaagaag tccgctcggg tctgggtcgc gcgcgcggcg tggaagtgac ggtcgactcg       420
     caactggcca ccgagcaact caacggcgac cgggagcgcc tcgccgccgc gctatggctg       480
     atgctcatgt tcgcggtaga aacgggcgcg gaaggcgcca cggtcaccct ggtcacgaaa       540
     gcggatacga acgcatggca tgctagcgtc gggtacgagg ccaacggcac ggcgttggac       600
     gatcccgcct tgccgcatgt actcgaagcg tttgcccgca agcaggcccg cgagccacgc       660
     gaagcgaagc ggatcgcgtg ggtgctggcg ctgtgcaagc gcgttgccga agcgcacggc       720
     ggcagtttcg agcaggtcga cgcaacgggc agcgacacgg ccacgctcgc cctgcgcgtg       780
     ccgctcagcg caacggctgc gaaatga                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page