(data stored in SCRATCH zone)

EMBL: CP000271.PE159

CP000271.PE159       Location/Qualifiers
FT   CDS_pept        184266..184988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2868"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2868"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33127"
FT                   /db_xref="GOA:Q13S12"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S12"
FT                   /protein_id="ABE33127.1"
FT                   /translation="MGYLLVLCVGLLAGMLSGVVGTGSSMMLMPVLVMLFGPQEAVPIM
FT                   AIAAIMGNFGKVLAWWREIDWRACGAYCVTAVPGAALGVRTLLALPPHAVEIALGLFFV
FT                   AMVPTRRWLARRAIKFSLWQLSLIGGVVGFLTGIVVSTGPITVPVFMSYGLVKGAFLAT
FT                   EAAGSLTVYASKVAVFNHFGALPLHVVIDGLITGSALMVGSFAARAIVVRMSPATFKLV
FT                   VDGLMLSSGLSLLWAAGR"
     atgggatatc tgctggtgct gtgcgtcgga ttgctggccg gcatgctgag cggcgtggtc        60
     ggcaccggct cgtcgatgat gctgatgccc gtcctcgtga tgctgttcgg tccgcaggag       120
     gcggtgccga tcatggcgat cgcggcaatc atgggcaact tcggcaaggt tctcgcatgg       180
     tggcgcgaga tcgactggcg ggcgtgcggc gcctactgcg tgaccgctgt gccgggcgcg       240
     gcgctgggcg tgcgaacgct gctcgcgttg ccgcctcatg cggtcgaaat tgcgcttggt       300
     ctgttctttg tcgcgatggt gcccacacgg cgatggctcg cgcggcgggc catcaaattc       360
     tcgctatggc agctttcgct gattggcggc gtggtgggtt ttctcaccgg gatcgtcgtt       420
     tccaccgggc cgattacggt gcccgtgttc atgtcctatg gcctcgtgaa aggcgctttt       480
     ctcgccaccg aagcggcggg ctcgctgacc gtctacgcgt ccaaagtcgc ggtcttcaac       540
     catttcggcg ctttgccttt gcacgtggtg atcgacggtt tgatcaccgg ttccgcgctg       600
     atggtcggct cgtttgccgc gcgggcgatc gtggtccgta tgagtcccgc tactttcaaa       660
     ctggtcgtcg acggtttgat gctgtcttcg ggactatcgc tgctgtgggc ggcgggccgc       720
     tag                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page