(data stored in SCRATCH zone)

EMBL: CP000271.PE163

CP000271.PE163       Location/Qualifiers
FT   CDS_pept        complement(192302..194521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2864"
FT                   /product="Putative glycogen operon protein GlgX"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2864"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33131"
FT                   /db_xref="GOA:Q13S08"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S08"
FT                   /protein_id="ABE33131.1"
FT                   /translation="MSHAMPDRLLPGSPYPLGASWDGLGVNFAVFSANAQKIELCLFDP
FT                   TGRKELRRFTLPECTDEVWHGYLPNAHPGTAYGFRAHGPYQPQHGHRFNPHKLLLDPYA
FT                   RKLVGQFRWSDALFGYRVHSNRADLSIDRRDSAPAMPKCVVIDEAFDWSHDKRPNVPWG
FT                   ETIVYETHVRGASMLRADLRQHERGTFAALASPEFIDHLLKLGVTAVELLPVHAFLNDR
FT                   FLVERGLRNYWGYNSAAFFAPEPSYLSTHRLDEMRIAVRQLHAAGIEVILDVVYNHTCE
FT                   GNEMGPTVSWRGLDNASYYRLIPGDERHHINDTGCGNTVNLPHPRVLQMVMDSLRYWST
FT                   AFNMDGFRFDLGVTLGREQHGFDPGSGFFDALRQDPILSQRKLISEPWDIGPGGYQLGN
FT                   HPPGFGEWNDRFRDTVRRFWRGDAGLRPDLAARLTGSADLFNRRFRKPWASVNFVTSHD
FT                   GFTLADVTAYEQKHNEANREDNNDGHNENCSRNWGVEGESDDPAILATRKRVARSLIAT
FT                   LLMALGTPMVLAGDESLRTQHGNNNAYCQDNELSWLDWARAESPDGRQMTAFVARVIAL
FT                   RKQHPLLRETRFLFGDREVLPGLFDVGWFDERGDPLTIEAWQDPEGRAFTLRRAGPGLN
FT                   GETEVLLMMLNANEKTLRFTPPAPHLEWHVLLDTAEPENAPHRLAVPEIEVAAHGLVML
FT                   AAQPVGEADWQAGWKPGPQHGPRLLTALPPDPGAHAPTNDASPTT"
     atgtcgcatg caatgcccga ccggcttctg cccggctcgc cctatccgct cggcgccagt        60
     tgggatggcc tcggcgtcaa ctttgcggtg ttctcggcaa acgcgcaaaa aatcgagctt       120
     tgtctgttcg atcccaccgg gcgcaaggaa ctgcgccgtt tcacgctgcc cgaatgcacc       180
     gacgaagtct ggcacggcta cctgcccaac gcgcatccgg gcaccgccta cgggtttcgc       240
     gcgcacgggc cgtatcagcc gcagcatgga catcgcttca atccgcacaa gctgctgctc       300
     gatccgtacg cgcgcaagct ggtcggacag tttcgctggt cggatgcgct attcggttat       360
     cgcgtgcatt cgaatcgcgc ggatctttcc atcgaccggc gcgattcggc gcccgccatg       420
     ccgaaatgcg tggtgatcga cgaggcgttc gactggtcgc acgacaagcg gcccaatgtg       480
     ccgtggggcg aaaccatcgt ctacgaaacg catgtgcgcg gcgcttcgat gctgcgcgcc       540
     gatttgcgcc agcatgaacg cggcacgttc gcggcgctgg cttcgccgga gttcatcgac       600
     catctgctga aactgggcgt gaccgcggtc gaattgctgc ccgtgcacgc gtttctcaac       660
     gatcgctttc tggtggaacg cggcctgcgc aactactggg gctacaactc ggcggcattt       720
     ttcgcgccgg agccgtccta cctcagcacg caccggctcg acgaaatgcg cattgccgtg       780
     cgccagttgc acgcggccgg catcgaggtc attctcgacg tggtctacaa ccacacctgc       840
     gaaggcaacg agatgggccc gacggtgtcg tggcgcggcc tcgacaacgc cagctattac       900
     cgcctgattc ccggcgacga acgccaccat atcaacgaca ccggctgcgg caacaccgtg       960
     aatctgccgc atccacgcgt gctgcaaatg gtgatggatt cgctacgcta ctggtcgacg      1020
     gcattcaata tggacggctt ccgtttcgat ctcggcgtca cgctcggtcg cgagcaacac      1080
     ggcttcgatc ccggctccgg tttcttcgac gccttgcgcc aggacccgat cctgtcgcaa      1140
     cgcaagctga tttccgagcc gtgggatatc gggccgggcg gttatcagct cggcaatcat      1200
     ccgccgggct tcggcgaatg gaacgaccgt ttccgcgaca ccgtgcgccg cttctggcgc      1260
     ggcgacgccg gcttgcggcc cgatctcgcc gcgcgtctga ccggctcggc cgatctgttc      1320
     aaccgccgct tcagaaagcc gtgggcgtcg gtcaatttcg tcacgtcgca tgacggtttt      1380
     acgttggccg acgtcaccgc ctacgagcag aagcacaacg aagcaaaccg cgaagacaac      1440
     aacgacggcc acaacgagaa ttgcagccgc aattggggcg tggaaggcga gagcgacgac      1500
     ccggcgattc tcgccacccg caagcgcgtg gcccgctcac tgatcgccac gctgctgatg      1560
     gcgctcggca cgccaatggt gctggccggc gacgaatcgc tgcgcaccca gcacggcaac      1620
     aacaatgcgt actgccagga caacgaactg tcgtggctcg actgggcgcg cgcggaatcg      1680
     ccggacggtc gccagatgac cgcgttcgtc gcgcgcgtga tcgcgttgcg caagcaacat      1740
     ccgctgttgc gcgaaacgcg tttcctgttc ggcgatcgtg aagtgttgcc cggtctgttc      1800
     gacgtgggct ggttcgacga gcggggcgac ccgctcacca tcgaagcctg gcaggatccc      1860
     gaaggccgcg cgttcacatt gcgccgcgcc ggcccaggct tgaacggcga aacagaagta      1920
     ttgttgatga tgctcaacgc caacgagaaa acactgcggt ttacgcctcc cgcaccgcat      1980
     ctggaatggc atgtgctgtt agacactgct gaacccgaga acgcaccgca tcggctggcg      2040
     gtcccggaga tcgaagtggc cgcgcacggc ctcgtgatgc tggccgcgca gccggtgggc      2100
     gaagcagact ggcaggcggg ctggaagccc ggcccgcagc atgggccgcg gctcctgacg      2160
     gcgcttccgc ccgatccggg tgcgcatgcg cccacgaacg acgcgtcgcc gaccacctag      2220
//

If you have problems or comments...

PBIL Back to PBIL home page