(data stored in SCRATCH zone)

EMBL: CP000271.PE164

CP000271.PE164       Location/Qualifiers
FT   CDS_pept        complement(194628..196838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2863"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /EC_number="2.4.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2863"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33132"
FT                   /db_xref="GOA:Q13S07"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13S07"
FT                   /protein_id="ABE33132.1"
FT                   /translation="MSEHDPAAGLQPLDIDALVEARHPDPFSQLGLHHTDAGPVVRALL
FT                   PNAAHVSVISRADGALLGELEQLRPGLFAGRITSAAPYRLRIDWHGVVQEIEDTYSFGP
FT                   VLGDEPLGRLAGGDPYAVLECLGARPMEVDGVPGVRFAVWAPNARRVSVVGDFNAWDGR
FT                   RHPMRLRHQAGVWELFVPRVGPGTRYKYELLSRDGHPLPLKADPCAMQTEKPPGTASIV
FT                   AHVDEVEQFPWSDHEWIQSRAGKQTARSPISIYEVHAESWLRVAEEGQRGLDWEELAER
FT                   MIPYVKSMGFTHVEFMPIAEHPFGGSWGYQPLGQFAPSARFGKPEQFARFVDKAHEAGL
FT                   GVILDWVPAHFPNDAHGLIDFDGTPLYEHADPREGYHQDWNTMIYNLGRNEVSAFLIAS
FT                   GLAWLKRYHVDGLRVDAVASMLYRDYSRAADQWVPNIYGGRENLESIAFLKRLNHEVGY
FT                   VPGVPGAITIAEESTAWPGVTARVEDGGLGFQFKWNMGWMHDTLHYMEEDPVYRQYHHH
FT                   NMTFGMVYAYSERFVLPLSHDEVVHGKGSLLGKMPGDRWQKFANLRAYFGFMWTHPGKK
FT                   LLFMGGEFGQLAEFNHDASPHWHLLDDSNHHGVQMLVRDLNRLYSDEPALYLLDCEPGG
FT                   FEWLIGDDSGNSVFAYRRTDGAGRELVVVCNMTPVPRLGYRIGMPRGGRWVEVLNTDAG
FT                   VYGGSNMGNGGLIHTDSQSSHGWPHSAALTLPPLATIVLRAD"
     atgagtgagc atgatccggc cgcaggcctc caaccgctcg atatcgacgc gctcgtcgaa        60
     gcgcgccacc ccgatccttt ttcgcagctc gggctgcatc acacggatgc gggtccggtg       120
     gtgcgcgcgc tgttgccgaa cgccgcgcac gtcagtgtga tttctcgcgc cgacggtgcg       180
     ttactcggcg agctcgaaca actgcggccg gggctctttg ccggccgcat cacgtccgcg       240
     gcgccgtacc gtttgcgcat cgactggcat ggcgtcgtgc aggaaatcga ggacacgtat       300
     tcgttcggtc ccgttctcgg cgatgagccg ctcggccggc tcgcgggcgg cgacccttat       360
     gcagtgctcg aatgtctcgg cgctcgcccg atggaagtgg acggcgtgcc gggtgtgcgc       420
     ttcgccgtgt gggcgccgaa cgcccggcgc gtctcggtgg taggcgactt caatgcatgg       480
     gacggccgcc gtcatccgat gcggctgcgg catcaggccg gcgtgtggga gctgttcgtg       540
     ccacgggtcg ggccaggtac gcgctacaaa tacgaactgc tgtcgcgcga cggccatccg       600
     ctgccgttga aggccgatcc gtgcgcgatg caaaccgaga agccgccggg tacggcctcg       660
     atcgtcgcgc atgtcgacga ggtcgagcag tttccgtgga gcgatcacga gtggatccag       720
     tcgcgcgccg gcaaacagac cgcgcgctcg cccatttcga tctacgaagt gcacgccgaa       780
     tcctggctgc gcgtcgcgga agaaggccag cgcgggctcg attgggaaga gctcgcggaa       840
     cggatgattc cgtacgtgaa aagcatgggc ttcacacacg tggagttcat gccgattgcg       900
     gagcatccgt tcggcggatc gtggggctat cagccactcg ggcaattcgc gccgtcggcg       960
     cgcttcggca aacccgagca gttcgcgaga ttcgtcgaca aggcgcacga agccggactc      1020
     ggcgtgatcc tcgactgggt gcccgcgcac tttccaaacg acgcgcacgg cctgatcgac      1080
     ttcgacggca cgccgctcta cgagcacgcc gacccgcgcg aaggctatca ccaggactgg      1140
     aacacgatga tctacaacct cggccgcaac gaggtgagcg cgttcctgat cgcctccggg      1200
     ctggcgtggc tcaagcgcta tcacgtcgac ggtttgcgcg tggatgcggt cgcgtcgatg      1260
     ctgtatcgcg actattcgcg cgccgccgac cagtgggtgc cgaacattta cggcggccgc      1320
     gagaatctcg aatcgatcgc cttcctcaag cgcctgaatc atgaagtggg ctatgtgccc      1380
     ggtgtgccgg gcgcgatcac gatcgccgag gaatcgaccg catggccggg cgtgacggcg      1440
     cgtgtcgaag acggcggcct gggtttccag ttcaagtgga acatgggctg gatgcacgac      1500
     acgctgcact acatggaaga agatccggtc taccgccaat accatcacca caacatgacg      1560
     ttcggcatgg tgtacgcgta ttcggagcgc ttcgtgctgc cgctttcgca cgacgaggtc      1620
     gtgcacggca aaggctcgct gctcggcaag atgcccggcg acaggtggca aaagttcgcc      1680
     aacctgcgcg cgtacttcgg tttcatgtgg acgcacccgg gcaagaagct gctgttcatg      1740
     ggcggcgaat tcggccagct ggcggaattc aatcacgacg cgtcaccgca ttggcatctg      1800
     ctcgacgatt cgaatcacca cggcgtgcaa atgctggtgc gcgacctgaa ccgtctgtat      1860
     agcgacgagc ccgcgctgta tctgctcgat tgtgagccgg gcggcttcga atggctgatc      1920
     ggcgacgaca gcggcaacag cgtcttcgcc tatcgccgca ccgacggcgc cggccgcgaa      1980
     ctcgtcgtgg tctgcaacat gacgccggtg ccgaggctcg gttaccggat cggcatgccg      2040
     cgcggcggac gctgggtgga agtgctcaac acggacgccg gcgtctacgg cggctcgaac      2100
     atgggcaacg gcgggctgat ccataccgac tcccaatcga gccacggctg gccgcattcc      2160
     gcggcactga cgctgccgcc gctcgcgacg atcgtattgc gcgcggattg a               2211
//

If you have problems or comments...

PBIL Back to PBIL home page