(data stored in SCRATCH zone)

EMBL: CP000271.PE166

CP000271.PE166       Location/Qualifiers
FT   CDS_pept        complement(200292..203732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2861"
FT                   /product="Putative alpha-amylase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2861"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33134"
FT                   /db_xref="GOA:Q13S05"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021828"
FT                   /db_xref="InterPro:IPR026585"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S05"
FT                   /protein_id="ABE33134.1"
FT                   /translation="MESPNGYAPRIYFFHSLLVGPLDAWPAQFAHAAGLGFDHALIGSL
FT                   FEPGQAGHGQVVGNHARLHPVFEAQQPATEAIRTLANAAAQNGLTLLADLVIDRMAADG
FT                   ALYAEHADWFHPFESEEARLDPRHVHREDNVAYANFNDPGSSAALAGWWTQQLLTLADA
FT                   GVGGFRFDSPHRVPGAVWRQLRDAVRAKHPEVRFLAATPGLAREDLRGLEGAGFDSVFS
FT                   SVRWWDFRSSWMVEEHAALARIGAPIAFPEAPYGTRLAAELSDAHDAAIVERAYRRALF
FT                   ASVAIGTGWMMPMGFEYGITEPMSQTRGDASQFALAAQAKQFDLSERITHVNQVVRNTK
FT                   TLHANGELRPLSGPGAPAAILLRADQPDLRDAREAVLIAINPELGAPLRVDPARFLAGV
FT                   PGNFTRFVPLDAPANASPATLTPFTLAPGAVRLLRAVAEKPIRLAPPIDKANSKRSGRK
FT                   TVLEAINAPRVAIESVTPSVDNGRFAAKRTVGEHAEITAAIFAEGHDKIAAAVIWRAAD
FT                   ETAWHEVPMTPAEPAGLDIWKARIPLERLGRHEFTVIAWRDDFASLVEHIQKKLKAGQT
FT                   VELELDEAAHLFALVLAEVETSEGAVTAPLEHIVKEFTKADAETKLALLLAPTTARAMT
FT                   AARHRPFLSRDPVIYKIDADRTAARFASWYEIFPRSMSDDESRHGTFADVTKKLPRIRD
FT                   MGFDVLYFPPIHPIGVANRKGRNNTLNAQPGDVGSPYAIGGVEGGHTAVHPQLGTLDDF
FT                   KAMLAAAHEHGLEIALDFAVQCSPDHPWLKEHPTWFAWRPDGTLRYAENPPKKYQDIVN
FT                   PDFYAHDAKPDLWLALRDVFLFWIEAGVHIFRIDNPHTKPLPFWEWVIGDIRARYPDTI
FT                   FLAEAFTRPRMMNRLGKIGFSQSYTYFTWRESKRDFIEYMTELTQTGARDSYRPNFFVN
FT                   TPDINPRHLQSQGRTGFLIRAALASTLAGLWGVYSGFELCEAAALPNSEEYLDSEKYQL
FT                   RAWDWNRPGNIVGEISALNRIRRANPALQTHLGLTFLPAHNDNVLFFEKATESRDNVIV
FT                   VAINLDPFNEQGADIELSWETFQKWNLPDHGPLEVTDQMTGARFEWHGRWQHVQLGSGQ
FT                   PFSIWRIAPLGGLPAERPDEADSDYHADAGNPTPTEGAT"
     atggaatctc cgaacgggta cgcgccgcgg atctactttt ttcattcact tctggttggg        60
     ccgctcgatg catggcctgc gcagttcgcg catgcagccg ggctgggctt cgatcatgcg       120
     ctgatcggca gcctcttcga gcctggacaa gccggccacg gacaggtggt gggcaatcac       180
     gcccgtttgc atccggtatt cgaggctcaa cagcccgcca ccgaggcaat tcgcacgctc       240
     gcgaacgccg ccgcccagaa cggcctgacc ttgctggccg atctggtgat cgaccggatg       300
     gccgccgatg gcgcgctata cgccgaacat gccgactggt tccacccgtt cgagtctgaa       360
     gaggcgcggc tcgatccgcg ccacgtgcat cgcgaggaca acgtcgcgta tgcgaacttc       420
     aacgaccccg gcagcagcgc cgcactggcc ggctggtgga cgcagcagtt gctaacgctc       480
     gccgacgccg gcgtgggcgg cttccggttc gattcgccgc atcgcgtgcc gggcgccgtc       540
     tggcgccagt tgcgcgacgc ggttcgcgcg aagcatcccg aggtgcgttt tctcgccgcc       600
     acgccgggcc tcgcccgcga ggatctgcgc ggcctcgaag gcgcgggttt cgacagtgtg       660
     ttttcgtcgg tgcgctggtg ggacttccgc tcgagctgga tggtcgagga acacgccgcg       720
     ctcgcgcgca tcggcgcgcc gatcgcgttt cccgaagcgc cctacggcac gcgcctcgcc       780
     gccgaattga gcgatgcgca cgacgcggcc atcgtcgagc gggcttaccg gcgcgcgctg       840
     ttcgcgtccg tggcgatcgg caccggctgg atgatgccga tgggtttcga atacggcatc       900
     accgagccga tgtcgcaaac gcgcggcgat gcttcacagt tcgccctcgc tgcccaggcc       960
     aaacaattcg atctctcgga acgcatcacg cacgtcaacc aggtggtgcg caacacaaag      1020
     acactgcacg ccaacggcga actgcgacca ctgagcggac ccggtgcacc ggcggcgata      1080
     ttgctgcgcg ccgaccaacc cgacctgcgc gatgcccgtg aagccgtcct gatcgcgatc      1140
     aatcccgaac tcggggcgcc gctgcgcgtc gatcccgccc gcttcctcgc gggcgtgccg      1200
     ggtaacttca cgcgctttgt accactcgac gcgcccgcca acgcttcgcc cgccacgctc      1260
     acgccgttca cgctcgcgcc gggcgcagtc cgcctgttgc gcgcggtcgc ggagaagccg      1320
     atccgtctcg cgccgcccat cgacaaagcg aacagcaagc gcagcggccg caagaccgtg      1380
     ctcgaagcga tcaacgcgcc gcgcgtggcg atcgagagcg tcacgccctc ggtcgacaac      1440
     ggccgcttcg cggccaagcg caccgtgggc gaacacgctg aaatcaccgc cgcgattttc      1500
     gccgaaggtc acgacaagat tgccgccgcc gtgatctggc gcgccgccga cgaaaccgcc      1560
     tggcacgaag tgccgatgac gccggccgaa cccgccggcc tcgatatctg gaaagcgcgc      1620
     attccgctcg aacgcctggg tcgtcacgaa ttcacagtga tcgcatggcg cgacgatttc      1680
     gcttcgctgg tcgagcatat tcagaagaag ctgaaggcgg gacagaccgt cgaactcgaa      1740
     ctcgacgaag ccgcgcatct gttcgcgctg gtgctcgccg aagtggaaac ctcggaaggc      1800
     gcggtcacgg cgccgctcga acatatcgtc aaggaattca ccaaggcgga cgctgaaacg      1860
     aagctcgcgc tgctgctcgc gccgaccacg gccagggcga tgaccgccgc gcgccaccgg      1920
     ccgttcctga gccgcgatcc ggtcatctac aagatcgatg cggaccgcac cgcagcgcgc      1980
     ttcgcgagct ggtacgagat cttcccgcgt tccatgagcg acgacgaatc gcgccacggc      2040
     accttcgccg atgtcacgaa gaaactgccg cgcattcgcg acatgggttt cgacgtgctg      2100
     tatttcccgc cgattcaccc gatcggcgtg gcgaatcgca aaggccgcaa caacacgctg      2160
     aacgcgcagc cgggcgacgt gggcagcccg tatgcgatcg gcggcgtgga aggcggccac      2220
     acggccgtgc atccgcaact gggcacgtta gacgacttca aggcgatgct cgccgccgcg      2280
     catgagcacg gcctcgaaat cgcgctcgac ttcgcggtgc aatgctcgcc ggatcacccg      2340
     tggctcaagg agcatccgac gtggttcgcc tggcgccccg acggcacgct gcgctacgcg      2400
     gaaaatccgc cgaagaagta tcaggacatc gtcaacccgg acttctatgc gcacgacgcc      2460
     aagccggatt tatggctcgc gctgagggac gtgttcctgt tctggatcga agcgggcgta      2520
     catattttcc gcatcgacaa tccgcacacc aagccgctgc cgttctggga atgggtgatc      2580
     ggcgatatcc gcgcgcgcta tcccgacacg atcttcctcg ccgaagcctt cacgcggccg      2640
     cgcatgatga atcgactcgg caagatcggc ttctcgcagt cgtacacgta cttcacgtgg      2700
     cgggaatcca aacgcgattt catcgagtac atgaccgagc tcacgcaaac cggtgcgcgc      2760
     gactcctacc ggccgaactt cttcgtcaat acgccggata tcaacccgcg gcatttgcaa      2820
     tcgcaggggc gcacgggctt tctgattcgc gcggccctcg cttccacgct ggccggcttg      2880
     tggggcgtgt atagcggttt cgagctatgc gaagcggcgg cattgccgaa cagcgaggaa      2940
     tatctcgact cggagaagta ccagttgcgc gcgtgggact ggaaccggcc cggcaacatt      3000
     gtcggcgaga tcagcgcgct gaaccggatc cgccgcgcga atccggcgct gcaaacacat      3060
     ctcggcctga cgttcctgcc cgcgcacaac gacaacgtcc tgttcttcga gaaggcgacc      3120
     gaatcacgcg acaacgtgat cgtcgtcgcg atcaatctcg acccgttcaa cgaacagggc      3180
     gcggatatcg aattgtcgtg ggagactttc cagaaatgga atctgcccga tcatggcccg      3240
     ctggaagtca ccgatcagat gaccggcgcg cgtttcgaat ggcacggccg ctggcagcat      3300
     gtccagttag ggtccggcca gccgttctcg atctggcgca tcgcgccgct cggcggcttg      3360
     cccgccgaac ggccggatga agccgacagc gactatcacg cagacgctgg caacccaacc      3420
     ccaacggaag gtgcgacatg a                                                3441
//

If you have problems or comments...

PBIL Back to PBIL home page