(data stored in ACNUC7421 zone)

EMBL: CP000271.PE167

CP000271.PE167       Location/Qualifiers
FT   CDS_pept        complement(204200..204775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2860"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2860"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33135"
FT                   /db_xref="GOA:Q13S04"
FT                   /db_xref="InterPro:IPR009781"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S04"
FT                   /protein_id="ABE33135.1"
FT                   /translation="MPGHPRPMVRVLAGWDAAIWSYLAMIWVYMAVADEGSVRESARRD
FT                   DENAGVVLMVICVATIASIAAIVLELASAKGTAGASTVWHYALTGLTMFGAWFLIPTIF
FT                   TQHYARLYYDPDLTETPLLFPDKALQPDYWDFLYFSFTIAVASQTSDVVLRSRSIRRAT
FT                   LAQSVLSFYFNVAVLGLCVNIAAGLLGS"
     atgccgggac accctcggcc aatggttcgc gtgctggccg gctgggacgc ggccatctgg        60
     agttatctgg cgatgatctg ggtgtacatg gccgtcgccg acgaaggcag cgtgcgcgaa       120
     tccgcccgcc gcgacgacga gaacgcgggc gtggtgctca tggtgatctg cgtggcgacc       180
     attgcgagta ttgccgccat cgtgctggaa ctggcgtcgg cgaagggaac agccggtgct       240
     tccacggtct ggcactacgc gctgacggga ctcaccatgt tcggcgcgtg gttcctcatc       300
     ccgaccatct tcacacagca ctacgcgcgc ctttactacg atcccgatct aacggaaacg       360
     ccgctgctgt ttcccgacaa agcgctccag ccggattact gggacttcct gtatttctcg       420
     ttcaccattg ccgtggcctc gcagacatcg gatgtcgtgt tgcgctcgcg ttcgattcgc       480
     cgcgccacgc tcgcgcaatc cgtcctgtcg ttctacttca acgtcgccgt actcggcttg       540
     tgcgtgaaca tcgcagcggg cctgctcggc tcgtaa                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page