(data stored in SCRATCH zone)

EMBL: CP000271.PE168

CP000271.PE168       Location/Qualifiers
FT   CDS_pept        204865..205407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2859"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2859"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33136"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S03"
FT                   /protein_id="ABE33136.1"
FT                   /translation="MVCERLRCRGFYSCCGRYLSNRQVTGYVFRNALACRFQLKGEWQA
FT                   AVFSPCVPCHAGGFIRMSSARRSPARIEFMRARKTARAAPDQVWGRGIDATRERHHAGT
FT                   VRQVENDSPSGVPMTDVPENNDAHHEVTHPAASLLLSSDSFSAARRAWVPGACAAAAPG
FT                   RANAAGPMAEVVTDSTQ"
     atggtgtgtg aacggctccg gtgtcgcgga ttctactcgt gctgcggccg gtatttgtcg        60
     aatcgacagg tcacaggcta tgtctttcgc aacgcgcttg cgtgccgctt tcagttgaaa       120
     ggcgaatggc aggcggcagt tttttcgcca tgcgtgccat gccatgcagg tggtttcata       180
     cggatgtcat cagcacgacg tagcccggct cgtattgagt tcatgcgggc tcgtaagacc       240
     gctcgagcgg cgccggacca ggtttggggt agaggaatcg acgccacgcg cgaacggcat       300
     cacgccggga ccgtgcggca ggttgagaac gactcaccct ctggagttcc catgacagat       360
     gttcccgaga ataatgatgc gcaccacgaa gtgacgcatc ctgcagcgtc gttgttgttg       420
     tcgtcagatt cgttttcagc ggcgcgcaga gcgtgggtgc ccggcgcatg cgccgcagcc       480
     gcgcccggcc gtgccaacgc ggccggccca atggccgaag tggtgacgga cagcacgcaa       540
     taa                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page