(data stored in SCRATCH zone)

EMBL: CP000271.PE169

CP000271.PE169       Location/Qualifiers
FT   CDS_pept        205707..206465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2858"
FT                   /product="Putative serine/threonine protein phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2858"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33137"
FT                   /db_xref="GOA:Q13S02"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S02"
FT                   /protein_id="ABE33137.1"
FT                   /translation="MPHYHGLMASVLVNPVEHHPANRSGRDFVVGDLHGCVDALRYLLR
FT                   VITFDPARDRLFSVGDLVDRGEHSELALALLDKPWFFAVLGNHEDMLCAVADGRVRRQW
FT                   WYGIGGLWAAQLSDERLQHYAEVLRGLPLARVVGSGKERFNVLHAEFFGTDAELDAGNF
FT                   SAETRQQLLWGRELALGNGDPQRQRGLSLTYCGHTPMRDIKQVGSQVFIDTGAFGPGGK
FT                   LTIVEPLALRRWSISVEEARAEGAAALALP"
     atgccgcatt atcatggact catggcttcc gtactcgtca atcccgttga acatcacccg        60
     gccaaccgga gcggtcgcga cttcgtggtc ggcgatctgc atggctgcgt cgatgcattg       120
     cgctatctgc tgcgcgtgat tacgttcgac ccggcgcgtg accggctctt ttcggtcggc       180
     gatctggtgg accgcggcga gcattccgaa ctcgctttgg ccctgctcga caagccgtgg       240
     ttttttgccg tgctcggcaa tcacgaagac atgctgtgcg ccgtcgccga tggacgcgtg       300
     cggcgccagt ggtggtatgg catcggcggt ctatgggcgg cgcaattatc cgacgaacgc       360
     ttgcagcact acgcggaggt tttgcgcggc ttgccgctcg cgcgcgtggt cggcagcggc       420
     aaggagcgtt tcaacgtgct tcacgcggaa ttcttcggca cggacgccga actcgacgcg       480
     gggaatttct ccgccgaaac ccgccagcaa ttgctgtggg gacgcgaact ggcgctgggc       540
     aatggcgatc cgcagcggca gcgcggactc tcgctgacct attgcggcca cacgccgatg       600
     cgcgacatca agcaggtcgg ctcgcaggtg tttatcgaca ccggcgcgtt cgggccgggc       660
     ggcaagctca cgatcgtgga gccgctggcg ttgcgccgct ggtcgatctc ggtcgaagag       720
     gcccgcgcgg aaggcgcggc agcgctggcg ctgccttga                              759
//

If you have problems or comments...

PBIL Back to PBIL home page