(data stored in SCRATCH zone)

EMBL: CP000271.PE17

CP000271.PE17        Location/Qualifiers
FT   CDS_pept        complement(16579..18354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3012"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3012"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32985"
FT                   /db_xref="GOA:Q13SF4"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SF4"
FT                   /protein_id="ABE32985.1"
FT                   /translation="MNVSVRSYLSPTLVLLAFDWPEGGTREDFLGFAIKRTPGFLATDG
FT                   QEREASSWLPNRLTFKGAVPDTQKDAPSNEAPIQKFMWWDARIDEADREKSFTYLVYPV
FT                   IGKPEAPQLLDAQKGECKISLPAHREESIGSWFNRAVVSSQAFARKVAALHLAPHAVPS
FT                   AAQALRLRTWLANDLQEVFALTLDHAQRAASAVYHLTDPLWAIPAFEAFGKKQGKASLA
FT                   IVYDSHKVSQKGKPPAPSPNQPAVDELGDVATFAPRDKTHIMHDKFIVVNNGNGAASPA
FT                   RVLTGSANFTTEGITEQANVLHLFDSPELATLYSDRAKALAGNPTIAATAKLTPGWSDP
FT                   IQIGSAQVRVCFSPEAKDSRLQIDTIVDAIGKAKHSVVFCLFMPTDEPLREACFAAGDK
FT                   GLMMFGLVNHISPKSAEAAEEAEKNGQTVSTTALANMELYHRGRDKRDVIDAEYFSPAT
FT                   VPAGFEPELRLFPGEHAPDYAPVIIHHKFLVIDAEGANPVVYTGSANMSNNSEHFNDEN
FT                   LLEIRDRRIAGMYLAEFLRLYEHYRARALAIRQKKNGDTHERLMLAPDGSWAKKYFIAD
FT                   SPEDKARVALAHGGD"
     atgaacgtca gcgtccgcag ctatctgtcc ccgaccctcg ttctgctcgc tttcgattgg        60
     cccgaaggcg gcacgcgtga agactttctc ggtttcgcca tcaaacgcac gcccgggttc       120
     ctcgcgaccg atgggcagga acgcgaagcc agcagttggc tacccaatcg cttgactttt       180
     aaaggcgcag tgccggatac gcagaaagac gcgccgtcga atgaggcgcc cattcagaaa       240
     ttcatgtggt gggatgcgcg aatcgacgaa gcggatcgcg agaagtcgtt tacctatctc       300
     gtctatccgg taatcggcaa gccggaggcg ccgcaattgc tcgacgcgca aaagggcgaa       360
     tgcaaaatca gtttgcccgc gcatagggag gagagcatcg gctcgtggtt caatcgcgcc       420
     gtggtcagct cacaggcttt cgcgcgcaag gtggccgcgc tgcatctcgc gccgcacgcg       480
     gtgccgtcgg cggcacaggc attgcggctg cgtacctggc tcgcgaacga cttgcaggaa       540
     gtcttcgcgc tcacgctcga tcatgcgcaa cgcgcggcgt cggcggtgta ccacctgacc       600
     gatccgcttt gggcgatacc tgcgttcgaa gcattcggca agaagcaggg caaagcgtcg       660
     ctcgctatcg tgtacgactc gcacaaggtg tcgcagaagg gcaagccgcc cgcgccgtcg       720
     ccgaatcagc ctgccgtcga cgaactcggc gatgtcgcca ccttcgcgcc gcgcgacaag       780
     acgcacatca tgcatgacaa gttcatcgtg gtgaacaacg gcaatggcgc ggcgtcaccg       840
     gcgcgcgtgc tgacaggttc ggccaatttc accaccgagg gcatcacgga gcaggcgaac       900
     gtgctgcatc tgttcgattc gccggaactg gccacgcttt acagcgaccg tgcgaaggcg       960
     ctcgccggca atccgaccat tgccgcgacc gcaaagctca cgccgggctg gtcggacccg      1020
     atccagatcg gcagcgcgca agtgcgggtc tgtttttcgc cggaagcgaa agactcgcgt      1080
     ttgcagatcg acacgatcgt cgatgcgatc ggcaaagcga agcactccgt ggtgttctgc      1140
     ctcttcatgc cgaccgatga gccactgcgc gaggcctgtt tcgcggccgg cgacaaaggc      1200
     ctgatgatgt tcggcctcgt caatcacatc agcccgaaat cggctgaagc ggcggaagag      1260
     gcggagaaga acgggcagac tgtctcgacg acggccctcg ccaacatgga gttgtatcac      1320
     cgtggccgcg acaagcgcga tgtgatcgac gccgagtatt tttcacccgc gactgtgccg      1380
     gcaggcttcg aacccgagct gcgccttttt ccgggcgagc acgcgccgga ttacgcaccc      1440
     gtcatcatcc accacaagtt cctggtgatc gacgcagagg gggcgaatcc ggttgtctac      1500
     acgggctcgg caaacatgag caacaactcc gaacatttca acgacgagaa cctgctggag      1560
     attcgcgacc gccgcattgc cggcatgtat ctcgcggagt ttctgcggct ctacgagcac      1620
     tatcgggcgc gcgcgttggc gatacggcag aagaagaacg gagacacgca cgagcgtttg      1680
     atgctggcgc cggacgggtc gtgggcgaaa aaatatttca tcgccgatag tccggaagac      1740
     aaggcacgtg ttgcgctggc gcacggcggc gattga                                1776
//

If you have problems or comments...

PBIL Back to PBIL home page