(data stored in ACNUC7421 zone)

EMBL: CP000271.PE170

CP000271.PE170       Location/Qualifiers
FT   CDS_pept        complement(206497..207198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2857"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2857"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33138"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S01"
FT                   /protein_id="ABE33138.1"
FT                   /translation="MTQPHWQDRWRTTQLDWAPAYRVIPTRFPAVNLFDRVASPEDFDA
FT                   LYALEAMTNDRLRTEVGELDLVPREERRFGPGYGPIMAALTHLNPLGSRFSDGTYGVFY
FT                   CARSRTTAIAETRYHTGKFLEATAEPPMRQQMRLYTVVAQGNVVDIRGDESVDLAVLSP
FT                   DDYLAGQSLGRAIREAGAPGIVYPSVRDDEGECLAAFSTTLLRDCHHAAYLEYNWNGKQ
FT                   VDIVFELNQVG"
     gtgacacaac cgcattggca ggaccgctgg cgtactacgc agctcgactg ggcacccgca        60
     tatcgcgtga ttccgacgcg ctttccggcc gtcaatctgt tcgaccgggt cgcctcaccg       120
     gaagatttcg acgcgctcta cgcgctcgaa gccatgacca acgaccgcct gcgcaccgag       180
     gtcggcgaac tcgatctggt gccgcgcgaa gagcgccgct tcgggccggg ctacgggccc       240
     atcatggccg cgctgacaca cctgaatccg ctcggcagcc gcttctcgga cggcacgtac       300
     ggcgtgttct attgcgcccg ctcgcgcacc accgcaatcg ccgaaacgcg ctatcacacg       360
     gggaaatttc tggaggcgac ggccgagccg cccatgcgcc agcagatgcg tctctacacc       420
     gtcgtcgcgc aaggcaatgt ggtggacatt cgcggagatg agtcggtgga tctcgcggtg       480
     ctgtcgccgg atgattatct ggccgggcag tcgctcggcc gagccatccg cgaggcgggt       540
     gcgccgggta tcgtgtatcc atcggtacgg gacgacgaag gcgaatgcct cgccgcgttc       600
     agcaccacgc ttctgcgcga ctgccatcat gctgcgtatc tggaatacaa ctggaacggc       660
     aagcaggtgg atatcgtgtt cgagctcaac caggtaggct ag                          702
//

If you have problems or comments...

PBIL Back to PBIL home page